Conserved Protein Domain Family
PRK09732

?
PRK09732: PRK09732 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 170072
View PSSM: PRK09732
Aligned: 28 rows
Threshold Bit Score: 212.325
Threshold Setting Gi: 16130877
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
91212385    7 MKTKVILSQQMASAIIAAGQEEAQKNNWSVSIAVADDGGHLLALSRMDDCAPIAAYISQEKARTAALGRRETKGYEEMVN 86 
260845729   1 MKTKVILSQQMASAIIAAGQEEAQKNNWSVSIAVADDGGHLLALSRMDDCAPIAAYISQEKARTAALGRRETKGYEEMVN 80 
260857109   1 MKTKVILSQQMASAIIAAGQEEAQKNNWSVSIAVADDGGHLLALSRMDDCAPIAAYISQEKARTAALGRRETKGYEEMVN 80 
260869731   1 MKTKVILSQQMASAIIAAGQEEAQKNNWSVSIAVADDGGHLLALSRMDDCAPIAAYISQEKARTAALGRRETKGYEEMVN 80 
291284352   1 MKTKVILSQQMASAIIAAGQEEAQKNNWSVSIAVADDGGHLLALSRMDDCAPIAAYISQEKARTAALGRRETKGYEEMVN 80 
110643208   1 MKTKVILSQQMASAIIAAGQEEAQKNNWSVSIAVADDGGHLLALSRMDDCAPIAAYISQEKARTAALGRRETKGYEEMVN 80 
110806885   1 MKTKVILSQQMASAIIAAGQEEAQKNNWSVSIAVADDGGHLLALSRMDDCAPIAAYISQEKARTAALGRRETKGYEEMVN 80 
117625277   1 MKTKVILSQQMASAIIAAGQEEAQKNNWSVSIAVADDGGHLLALSRMDDCAPIAAYISQEKARTAALGRRETKGYEEMVN 80 
56480230    1 MKTKVILSQQMASAIIAAGQEEAQKNNWSVSIAVADDGGHLLALSRMDDCAPIAAYISQEKARTAALGRRETKGYEEMVN 80 
30064327    1 MKTKVILSQQMASAIIAAGQEEAQKNNWSVSIAVADDGGHLLALSRMDDCAPIAAYISQEKARTAALGRRETKGYEEMVN 80 
91212385   87 NGRTAFVTAPLLTSLEGGVPVVVDGQIIGAVGVSGLTGAQDAQVAKAAAAVLAK 140
260845729  81 NGRTAFVTAPLLTSLEGGVPVVVDGQIIGAVGVSGLTGAQDAQVAKAAAAVLAK 134
260857109  81 NGRTAFVTAPLLTSLEGGVPVVVDGQIIGAVGVSGLTGAQDAQVAKAAAAVLAK 134
260869731  81 NGRTAFVTAPLLTSLEGGVPVVVDGQIIGAVGVSGLTGAQDAQVAKAAAAVLAK 134
291284352  81 NGRTAFVTAPLLTSLEGGVPVVVDGQIIGAVGVSGLTGAQDAQVAKAAAAVLAK 134
110643208  81 NGRTAFVTAPLLTSLEGGVPVVVDGQIIGAVGVSGLTGAQDAQVAKAAAAVLAK 134
110806885  81 NGRTAFVTAPLLTSLEGGVPVVVDGQIIGAVGVSGLTGAQDAQVAKAAAAVLAK 134
117625277  81 NGRTAFVTAPLLTSLEGGVPVVVDGQIIGAVGVSGLTGAQDAQVAKAAAAVLAK 134
56480230   81 NGRTAFVTAPLLTSLEGGVPVVVDGQIIGAVGVSGLTGAQDAQVAKVAAAVLAK 134
30064327   81 NGRTAFVTAPLLTSLEGGVPVVVDGQIIGAVGVSGLTGAQDAQVAKVAAAVLAK 134
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap