Conserved Protein Domain Family
focB

?
PRK09713: focB 
formate transporter
Statistics
?
PSSM-Id: 137485
View PSSM: PRK09713
Aligned: 20 rows
Threshold Bit Score: 447.585
Threshold Setting Gi: 260845122
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15803015    1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80 
15832608    1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80 
209397824   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80 
254794437   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80 
291283712   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80 
170683125   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLTVIADAPSSQALTHLVGGLCFTLGFIL 80 
218700949   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLTVIADAPSSQALTHLVGGLCFTLGFIL 80 
260856586   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80 
260869181   1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80 
82777871    1 MRNKLSFDLQLSARKAAIAERIAAHKIARSKVSVFLMAMSAGVFMAIGFTFYLSVIADAPSSQALTHLVGGLCFTLGFIL 80 
15803015   81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
15832608   81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
209397824  81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
254794437  81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
291283712  81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
170683125  81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
218700949  81 LAVCGTSLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
260856586  81 LAVCGTNLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
260869181  81 LAVCGTNLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
82777871   81 LAVCGTNLFTSSVMTVMAKSRGVISWRTWLINALLVACGNLAGIACFSLLIWFSGLVMSENAMWGVAVLHCAEGKMHHTF 160
15803015  161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
15832608  161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
209397824 161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
254794437 161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
291283712 161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
170683125 161 TESVSLGIMCNVMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADH 240
218700949 161 TESVSLGIMCNVMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADH 240
260856586 161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
260869181 161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTSFWQLAHSSADN 240
82777871  161 TESVSLGIMCNLMVCLALWMSYCGRSLCDKIVAMILPITLFVASGFEHCIANLFVIPFAIAIRHFAPTPFWQLAHSSADN 240
15803015  241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQES 282
15832608  241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQES 282
209397824 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQES 282
254794437 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQES 282
291283712 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQES 282
170683125 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQEP 282
218700949 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQEP 282
260856586 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSMCYRAIYLRQES 282
260869181 241 FPALTVSHFITANLLPVMLGNIIGGAVLVSMCYRAIYLRQES 282
82777871  241 FPALTVSHFITANLLPVMLGNIIGGAVLVSICYRAIYLRQEL 282
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap