Conserved Protein Domain Family
PRK09702

?
PRK09702: PRK09702 
PTS sugar transporter subunit IIB
Statistics
?
PSSM-Id: 77355
View PSSM: PRK09702
Aligned: 2 rows
Threshold Bit Score: 331.291
Threshold Setting Gi: 56480418
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
56480418   1 MFSNHADMMLTQIAIGLCFTLLYFVVFRTLILQFNMCTPGREDAEVKLYSKAEYKASRGQTTAAEPKKELDQAAGILQAL 80 
30064993   1 MFSNHADMMLTQIAIGLCFTLLYFVVFRTLILQFNMCTPGREDAEVKLYSKAEYKASRGQTTAAEPKKELDQAAGILQAL 80 
56480418  81 GGVGNISSINNCATRLRIALHDMSQTLDDEVFKKLGAHGVFRSGDAIQVIIGLHVSQLREQLDSLINSHQSAENVAITEA 160
30064993  81 GGVGNISSINNCATRLRIALHDMSQTLDDEVFKKLGAHGVFRSGDAIQVIIGLHVSQLREQLDSLINSHQSAENVAITEA 160
56480418 161 V 161
30064993 161 V 161
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap