Conserved Protein Domain Family
PRK09692

?
PRK09692: PRK09692 
integrase; Provisional
Statistics
?
PSSM-Id: 170049
View PSSM: PRK09692
Aligned: 8 rows
Threshold Bit Score: 844.305
Threshold Setting Gi: 242240627
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16130540    1 MARKTKPLTDTEIKAAKPKDADYQLYDGDGLTLLIKSSGSKLWQFRYYRPLTKQRTKQSFGAYPAVSLSDARKLRAESKV 80 
238901780   1 MARKTKPLTDTEIKAAKPKDADYQLYDGDGLTLLIKSSGSKLWQFRYYRPLTKQRTKQSFGAYPAVSLSDARKLRAESKV 80 
24113958    1 MARQTKPLSVKEIESAKPKEADYVLYDGDGLELLIKSSGSKIWQFRYIRPVTKTRAKKSIGPYPSVTLADARNYRAESRS 80 
30064019    1 MARQTKPLSVKEIESAKPKEADYVLYDGDGLELLIKSSGSKIWQFRYIRPVTKTRAKKSIGPYPSVTLADARNYRAESRS 80 
110806713   1 MVRQTKPLSVKEIESAKPKEADYVLYDGDGLELLIKSSGSKIWQFRYIRPVTKTRAKKSIGPYPSVTLADARNYRAESRS 80 
218696244   1 MARQTKPLSVKEIESAKPKEADYVLYDGDGLELLIKSSGSKIWQFRYIRPVTKKRAKKSIGSYPSVTLADARNYRAESRS 80 
242240627   1 MARLTKPLTDTEIKAAKPQEADYTLHDGDGLQLLIKSSGRKVWQMRYYRPLTKKRVKLTFGPYPEVTLADARQRRTAARA 80 
186894531   1 MARQTKPLTDTEIKAAKPKDADYQLYDGDGLTLLIKSSGSKLWQFRYYRPLTKLRTKQSFGAYPAVSLSDARKLRAESRS 80 
16130540   81 LLAKDIDPQEHQKEQVRNSQEAKTNTFLLVAERWWNVKKTSVTEDYADDIWRSLERDIFPAIGDISITEIKAHTLVKAVQ 160
238901780  81 LLAKDIDPQEHQKEQVRNSQEAKTNTFLLVAERWWNVKKTSVTEDYADDIWRSLERDIFPAIGDISITEIKAHTLVKAVQ 160
24113958   81 LLAKQIDPQEHQQEQLRSSLEAKTNTFQLVAERWWNVKKASVTEDYAEDIWRSLERDVFPAIGDVSVTDIKAHTLVQAVQ 160
30064019   81 LLAKQIDPQEHQQEQLRSSLEAKTNTFQLVAERWWNVKKASVTEDYAEDIWRSLERDVFPAIGDVSVTDIKAHTLVQAVQ 160
110806713  81 LLAKQIDPQEHQQEQLRSSLEAKTNTFQLVAERWWNVKKASVTEDYAEDIWRSLERDVFPAIGDVSVTDIKAHT------ 154
218696244  81 LLAKQIDPQEHQQEQLRSSLEAKTNTFQLVAERWWNVKKASVTEDYAEDIWRSLERDVFPAIGDVSVTDIKAHTLVQAVQ 160
242240627  81 LLVKDIDPYEHQLSLRKQALETQSNTFKVVAERWLQLKKSSVTADYASDIRRSLEKDIFPAIGDISITDIKARTLVQAIQ 160
186894531  81 LLAKEIDPQEHQKEQVRNSHEAKTNTFLLVAERWWYLKKASVTEDYAQDIWRSLERDVFPVIGDISVTEIKAHTLVKAIQ 160
16130540  161 PVQARGALETVRRLCQRINEVMIYAQNTGLIDAVPSVNIGKAFEKPQKKNMPSIRPDQLPQLMHTMRTASISMSTRCLFM 240
238901780 161 PVQARGALETVRRLCQRINEVMIYAQNTGLIDAVPSVNIGKAFEKPQKKNMPSIRPDQLPQLMHTMRTASISMSTRCLFM 240
24113958  161 PVQARGALETVRRLCQRINEVMIYAQNTGLIDAVPSVNIGKAFEKPQKKNMPSIRPDQLSQLMQTMRTASISLSTRCLFM 240
30064019  161 PVQARGALETVRRLCQRINEVMIYAQNTGLIDAVPSVNIGKAFEKPQKKNMPSIRPDQLSQLMQTMRTASISLSTRCLFM 240
110806713 155 PVQARGALETVRRLCQRINEVMIYAQNTGLIDAVPSVNIGKAFEKPQKKNMPSIRPDQLSQLMQTMRTASISLSTRCLFM 234
218696244 161 PVQARGALETVRRLCQRINEVMIYAQNTGLIDAVPSVNIGKAFEKPQKKNMPSIRPDQLPQLMQTMRTASISLSTRCLFM 240
242240627 161 PVQARGALETVRRLCQRINEVMIYAMNVGLIDAAPSVNISKAFEKPQKKHMPSIRPDQLPQLMQTMRLANIELPTCCLFM 240
186894531 161 PVQARGALETVRRLCQRINEVMIYAQNTGLIDAVPSINIGKAFEKPQKKNMPSIRPDQLPQLMQTMRTANIILPTRCLFM 240
16130540  241 WQLLTITRPAEAAEARWDEIDFNASEWKIPAARMKMNRDHTVPLSDGALAILEMMKPLSGGREFIFPSRIKPNQPMNSQT 320
238901780 241 WQLLTITRPAEAAEARWDEIDFNASEWKIPAARMKMNRDHTVPLSDGALAILEMMKPLSGGREFIFPSRIKPNQPMNSQT 320
24113958  241 WQLLTITRPAEAAEARWEEVDIEAQEWKIPAARMKMNRDHTVPLSDEAIAVLEMMKPLSGNREFIFPSRIKPNQPMNSQT 320
30064019  241 WQLLTITRPAEAAEARWEEVDIEAQEWKIPAARMKMNRDHTVPLSDEAIAVLEMMKPLSGNREFIFPSRIKPNQPMNSQT 320
110806713 235 WQLLTITRPAEAAEARWEEVDIEAQEWKIPAARMKMNRDHTVPLSDEAIAVLEMMKPLSGNREFIFPSRIKPNQPMNSQT 314
218696244 241 WQLLTITRPAEAAEALWEEVDIEAREWKIPAARMKMNRDHTVPLSDEAIAILEMMKPLSGNREFIFPSRIKPNQPMNSQT 320
242240627 241 WQLLTLTRPVEAAETRWQEIDLDAKEWRIPAERMKMKRVHIVPLSEQALAILELMRPLSSHREYVFPSRIKPLQPMNSQT 320
186894531 241 WQLLTITRPAEAAEARWDEINFDAKEWKIPAARMKMNREHTVPLSDEALTILEMMKPLSSNREFIFPSRIKPTQSMNSQT 320
16130540  321 VNAALKRAGLGGVLVSHGLRSIASTALNEEGFPPDVIEAALAHVDKNEVRRAYNRSDYLEQRRPMMQWWADLVKAADSGS 400
238901780 321 VNAALKRAGLGGVLVSHGLRSIASTALNEEGFPPDVIEAALAHVDKNEVRRAYNRSDYLEQRRPMMQWWADLVKAADSGS 400
24113958  321 VNASLKRAGFGGVLVSHGLRSIASTALNEQGFPPDAIEAALAHVDKNEVRRAYNRSDYLEQRRPMMQWWANFVMAADRGS 400
30064019  321 VNASLKRAGFGGVLVSHGLRSIASTALNEQGFPPDAIEAALAHVDKNEVRRAYNRSDYLEQRRPMMQWWANFVMAADRGS 400
110806713 315 VNASLKRAGFGGVLVSHGLRSIASTALNEQGFPPDAIEAALAHVDKNEVRRAYNRSDYLEQRRPMMQWWANFVMAADRGS 394
218696244 321 VNASLKRAGFGGVLVSHGLRSIASTALNEQGFPPDVIEAALAHVDKNEVRRAYNRSDYLEQRRPMMQWWADFVMAADHGS 400
242240627 321 VNAALKRAGLGGILVSHGMRSIASTALNEQGFPPDVIEAALAHVDKNEVRRAYNRSDYLEQRRPMMQWWADFVKAADNGS 400
186894531 321 VNAALKRAGLGGILVSHGLRSIASTALNEQGFSPDVIEAALAHVDKNEVRRAYNRSDYLEQRRPMMQWWADFVNKADSGS 400
16130540  401 IVLTHLSKIRLVG 413
238901780 401 IVLTHLSKIRLVG 413
24113958  401 MIEGGIKGMKLVG 413
30064019  401 MIEGGIKGMKLVG 413
110806713 395 MIEGGIKGMKLVG 407
218696244 401 MIEGGIKAMRLVG 413
242240627 401 VLEGGIRGLKAIG 413
186894531 401 IITNGKRELKLVV 413
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap