Conserved Protein Domain Family
PRK09687

?
PRK09687: PRK09687 
putative lyase; Provisional
Statistics
?
PSSM-Id: 170047
View PSSM: PRK09687
Aligned: 18 rows
Threshold Bit Score: 335.174
Threshold Setting Gi: 17232905
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
260870325   1 MSNTYQKRKASKEYGLYNQCKKLNDDELFRLLDDHNSLKRIS------------------SARVLQLRGGQDAVRLAIEF 62 
170018176   1 MSNTYQKRKASKEYGLYNQCKKLNDDELFRLLDDHNSLKRIS------------------SARVLQLRGGQDAVRLAIEF 62 
170083101   1 MSNTYQKRKASKEYGLYNQCKKLNDDELFRLLDDHNSLKRIS------------------SARVLQLRGGQDAVRLAIEF 62 
238902684   1 MSNTYQKRKASKEYGLYNQCKKLNDDELFRLLDDHNSLKRIS------------------SARVLQLRGGQDAVRLAIEF 62 
253771567   1 MSNTYQKRKASKEYGLYNQCKKLNDDELFRLLDDHNSLKRIS------------------SARVLQLRGGQDAVRLAIEF 62 
254163521   1 MSNTYQKRKASKEYGLYNQCKKLNDDELFRLLDDHNSLKRIS------------------SARVLQLRGGQDAVRLAIEF 62 
260858010   1 MSNTYQKRKASKEYGLYNQCKKLNDDELFRLLDDHNSLKRIS------------------SARVLQLRGGQDAVRLAIEF 62 
256424152   1 ----------------MSRNDWTNDKLFERLINNQSTRTYWE------------------NIKTLCSRPEKAVFKRCATL 46 
17232905    1 MHSSRRLHSSSITSSLISLYAGVQMNPSNNHFENFQNEERSTiqiiqlaggeedeetywnYVWILRARGGNEEFVAASKL 80 
218550758   3 IIDKNKKRRENRETFLYAKYKAYTLNQLIPLLFKKNSLTRQA------------------AIFRLQIIGTDEVFTFAVNL 64 
260870325  63 CSDKNYIRRDIGAFILGQIKICKKC--EDNVFNILNNMALNDKSACVRATAIESTAQRCKKNPIYSPKIVEQSQITAFDK 140
170018176  63 CSDKNYIRRDIGAFILGQIKICKKC--EDNVFNILNNMALNDKSACVRATAIESTAQRCKKNPIYSPKIVEQSQITAFDK 140
170083101  63 CSDKNYIRRDIGAFILGQIKICKKC--EDNVFNILNNMALNDKSACVRATAIESTAQRCKKNPIYSPKIVEQSQITAFDK 140
238902684  63 CSDKNYIRRDIGAFILGQIKICKKC--EDNVFNILNNMALNDKSACVRATAIESTAQRCKKNPIYSPKIVEQSQITAFDK 140
253771567  63 CSDKNYIRRDIGAFILGQIKICKKC--EDNVFNILNNMALNDKSACVRATAIESTAQRCKKNPIYSPKIVEQSQITAFDK 140
254163521  63 CSDKNYIRRDIGAFILGQIKICKKC--EDNVFNILNNMALNDKSACVRATAIESTAQRCKKNPIYSPKIVEQSQITAFDK 140
260858010  63 CSDKNYIRRDIGAFILGQIKICKKC--EDNVFNILNNMALNDKSACVRATAIESTAQRCKKNPIYSPKIVEQSQITAFDK 140
256424152  47 TRSKVPRERRIGIDVLSQLGGAARPy-QAETLALYVRILPEETDLKVLESLLHAIGHNNTGMDNHSAEKLAALKTHRYA- 124
17232905   81 CESPSPKERTLGVDILAMLGMPQRTfpQQSVDILLKLLSSESNSNVLSTIGFAFGYLKDSRGVLPLINLKNHPDV----- 155
218550758  65 CQSEGKQERKTGISILSQLSMSPEH--LTQSFNLVEALLEKETSANVRAAAVNAIGHFCRRNPSFNSRAPELLTRTTYDK 142
260870325 141 STNVRRATAFAISVINDKATIPLLINLLKDPNGDVRNWAAFAININ-KYDNSDIRDCFVEML------QDKNEEVRIEAI 213
170018176 141 STNVRRATAFAISVINDKATIPLLINLLKDPNGDVRNWAAFAININ-KYDNSDIRDCFVEML------QDKNEEVRIEAI 213
170083101 141 STNVRRATAFAISVINDKATIPLLINLLKDPNGDVRNWAAFAININ-KYDNSDIRDCFVEML------QDKNEEVRIEAI 213
238902684 141 STNVRRATAFAISVINDKATIPLLINLLKDPNGDVRNWAAFAININ-KYDNSDIRDCFVEML------QDKNEEVRIEAI 213
253771567 141 STNVRRATAFAISVINDKATIPLLINLLKDPNGDVRNWAAFAININ-KYDNSDIRDCFVEML------QDKNEEVRIEAI 213
254163521 141 STNVRRATAFAISVINDKATIPLLINLLKDPNGDVRNWAAFAININ-KYDNSDIRDCFVEML------QDKNEEVRIEAI 213
260858010 141 STNVRRATAFAISVINDKATIPLLINLLKDPNGDVRNWAAFAININ-KYDNSDIRDCFVEML------QDKNEEVRIEAI 213
256424152 125 --VIRFGVACALKGVDKPAAIDTLITLSADKDTDIRDWATFALGSQiSRNNKAIREALWART------NEANEDTRMEAI 196
17232905  156 --DVRMGVVFGLISQSNELAIQALIDLSSDECEDIRNWATFGLGSQiETDTPAIRDALFARVisetgqEDTIAEIRGEAL 233
218550758 143 SVNTRCATAAALSEINNIKAIPLLLSLLNDSNGDVRNWAAFSVNTN-EYDSKEIREAFVKML------SDDHEHARLEAI 215
260870325 214 IGLSYRKDKRVLSVLCDELKKNTVYDDIIEAAGELGDKTLLPVLDTMLYKFD-DNEIITSAIDKLKRS 280
170018176 214 IGLSYRKDKRVLSVLCDELKKNTVYDDIIEAAGELGDKTLLPVLDTMLYKFD-DNEIITSAIDKLKRS 280
170083101 214 IGLSYRKDKRVLSVLCDELKKNTVYDDIIEAAGELGDKTLLPVLDTMLYKFD-DNEIITSAIDKLKRS 280
238902684 214 IGLSYRKDKRVLSVLCDELKKNTVYDDIIEAAGELGDKTLLPVLDTMLYKFD-DNEIITSAIDKLKRS 280
253771567 214 IGLSYRKDKRVLSVLCDELKKNTVYDDIIEAAGELGDKTLLPVLDTMLYKFD-DNEIITSAIDKLKRS 280
254163521 214 IGLSYRKDKRVLSVLCDELKKNTVYDDIIEAAGELGDKTLLPVLDTMLYKFD-DNEIITSAIDKLKRS 280
260858010 214 IGLSYRKDKRVLSVLCDELKKNTVYDDIIEAAGELGDKTLLPVLDTMLYKFD-DNEIITSAIDKLKRS 280
256424152 197 VGLALRKDLRVMDLIRKELQRGDAGTLLFEAITELGTKEFLPDLKKLHKQSAnDTSIHPTWRMKLEET 264
17232905  234 LGLALRKDERVINPLIAELESGCVGRLAVEAAKEIGDARLYSALINLQQWWDvDIKLLLEAISSCNSN 301
218550758 216 FGLAERKDSRVVKTIINELEKDIIFDELIVVAGDLGSKRFLPVLKKLLSEFN-DEKTIGKIKIAIQKI 282
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap