Conserved Protein Domain Family
PRK09677

?
PRK09677: PRK09677 
putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional
Statistics
?
PSSM-Id: 137467
View PSSM: PRK09677
Aligned: 5 rows
Threshold Bit Score: 305.647
Threshold Setting Gi: 126175083
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16129973    3 LKLAKRYGLCGFIRLVRDVLLTRVFYRNCRIIRFPCYIRNDGSINFGENFTSGVGLRLDAFG-----RGVIFFSDNVQVN 77 
170081663   3 LKLAKRYGLCGFIRLVRDVLLTRVFYRNCRIIRFPCYIRNDGSINFGENFTSGVGLRLDAFG-----RGVIFFSDNVQVN 77 
126175083   1 -MRVRGYNLSGILYLVFCFCYTKCFYKQSRLIRLPFRTRQFSKIKGMVGFTTGVDCRIDVFT-----NAKLEIGDDVQIN 74 
218708287   1 MNLFKSYGVMGVMRLIRDVVFTKLFNARCRIIRYPFYIRGAKHISFSKGFTSGVGLRLDTFEinanqTPKLSFGINCQVN 80 
238901223   3 LKLAKRYGLCGFIRLVRDVLLTRVFYRNCRIIRFPCYIRNDGSINFGENFTSGVGLRLDAFG-----RGVIFFSDNVQVN 77 
16129973   78 DYVHIASIESVTIGRDTLIASKVFITDHNHGSFKHSDPMSSPNIPPDMRTLESSAVVIGQRVWLGENVTVLPGTIIGNGV 157
170081663  78 DYVHIASIESVTIGRDTLIASKVFITDHNHGSFKHSDPMSSPNIPPDMRTLESSAVVIGQRVWLGENVTVLPGTIIGNGV 157
126175083  75 DNVHIACAEYIKIGKNTLIASKVYLTDHDH-------DFTSGKLKPIDWPLKSEPLIIGDNCWIGENVCILKGVSIGDGC 147
218708287  81 DYVHIGCIESIEIGDDVLIASKVFITDHNHGDLDEPTDFL---LPPSKRGLTSKKVKIGNQTWIGESVMILPGVSIGNNC 157
238901223  78 DYVHIASIESVTIGRDTLIASKVFITDHNHGSFKHSDPMSSPNIPPDMRTLESSAVVIGQRVWLGENVTVLPGTIIGNGV 157
16129973  158 VVGANSVVRGSIPENTVIAGVPAKIIKKYNHETKLWE 194
170081663 158 VVGANSVVRGSIPENTVIAGVPAKIIKKYNHETKLWE 194
126175083 148 IVGANAVVTKSFPNGVIIAGNPAKIIRFR-------- 176
218708287 158 IIGAGSVVTKNIPDYSVAVGNPAKVIKIFDVERNDWK 194
238901223 158 VVGANSVVRGSIPENTVIAGVPAKIIKKYNHETKLWE 194
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap