Conserved Protein Domain Family
PRK09649

?
PRK09649: PRK09649 
RNA polymerase sigma factor SigC; Reviewed
Statistics
?
PSSM-Id: 137458
View PSSM: PRK09649
Aligned: 11 rows
Threshold Bit Score: 291.944
Threshold Setting Gi: 183983052
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
31793252    2 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 81 
15827760    1 MIASSGDEAVTDLALAAARGSKRALEAFIKATQQDVWRFVAYLSDVGNADDLTQETFLRAIGAIERFSGHSSGRTWLLAI 80 
221230237   1 MIASSGDEAVTDLALAAARGSKRALEAFIKATQQDVWRFVAYLSDVGNADDLTQETFLRAIGAIERFSGHSSGRTWLLAI 80 
15609206    2 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 81 
148823283 128 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 207
148661883   2 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 81 
253798874 128 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 207
183983052   1 MTTSPDDEAVTALALAAADGDARAFEAFIKATQQDVWRFVAYLSDAGSADDLTQETFLRAIGAIRRFGGRSSARTWLLAI 80 
118617811   3 MTTSPDDEAVTALALAAADGDARAFEAFIKATQQDVWRFVAYLSDAGSADDLTQETFLRAIGAIRRFGGRSSARTWLLAI 82 
121637954   2 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 81 
224990448   2 TATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLRAIGAIPRFSARSSARTWLLAI 81 
31793252   82 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 161
15827760   81 ARRVVADHIRRAQTRPRTTFDGYPERMLNADRHARGFEDLVEVTTMIANLATEQREALLLTQLLGLPYADAAAVCGCPVG 160
221230237  81 ARRVVADHIRRAQTRPRTTFDGYPERMLNADRHARGFEDLVEVTTMIANLATEQREALLLTQLLGLPYADAAAVCGCPVG 160
15609206   82 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 161
148823283 208 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 287
148661883  82 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 161
253798874 208 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 287
183983052  81 ARRVVADHIRHLQARPRAAHGVDPELLLDRGRRARGFEDLVEVTTMIAQLTSDQREALLLTQLLGLSYTDAAAVCGCPVG 160
118617811  83 ARRVVADHIRHLQARPRAAHGVDPELLLDRGRRARGFEDLVEVTTMIAQLTSDQREALLLTQLLGLSYTDAAAVCGCPVG 162
121637954  82 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 161
224990448  82 ARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVG 161
31793252  162 TIRSRVARARDALLADAEPDDLTG 185
15827760  161 TIRSRVARARDALLADTEHNHLTG 184
221230237 161 TIRSRVARARDALLADTEHNHLTG 184
15609206  162 TIRSRVARARDALLADAEPDDLTG 185
148823283 288 TIRSRVARARDALLADAEPDDLTG 311
148661883 162 TIRSRVARARDALLADAEPDDLTG 185
253798874 288 TIRSRVARARDALLADAEPDDLTG 311
183983052 161 TIRSRVARARDALLADNERDDLTG 184
118617811 163 TIRSRVARARDALLADNERDDLTG 186
121637954 162 TIRSRVARARDALLADAEPDDLTG 185
224990448 162 TIRSRVARARDALLADAEPDDLTG 185
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap