Conserved Protein Domain Family
PRK09644

?
PRK09644: PRK09644 
RNA polymerase sigma factor SigM; Provisional
Statistics
?
PSSM-Id: 170033
View PSSM: PRK09644
Aligned: 20 rows
Threshold Bit Score: 223.602
Threshold Setting Gi: 169828654
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30263235    1 MEIEEIYKIYINDVYRYLFSLSRSHHAAEDLMQETFYRAYLYLEDYENQKVKSWLFKVAYHTFIDFVRKEKKVSFVGTEE 80 
154685410   1 MTIDEIYQMYMNDVYRFLLSMTKDKHLAEDLLQETFMRAYIHIHSYDHSKVKPWLFQVARNAFIDYVRKHKKEVTISDDL 80 
49186087    1 MEIEEIYKIYINDVYRYLFSLSRSHHAAEDLMQETFYRAYLYLEDYENQKVKSWLFKVAYHTFIDFVRKEKKVSFVGTEE 80 
47528609    1 MEIEEIYKIYINDVYRYLFSLSRSHHAAEDLMQETFYRAYLYLEDYENQKVKSWLFKVAYHTFIDFVRKEKKVSFVGTEE 80 
227813895   1 MEIEEIYKIYINDVYRYLFSLSRSHHAAEDLMQETFYRAYLYLEDYENQKVKSWLFKVAYHTFIDFVRKEKKVSFVGTEE 80 
229604117   1 MEIEEIYKIYINDVYRYLFSLSRSHHAAEDLMQETFYRAYLYLEDYENQKVKSWLFKVAYHTFIDFVRKEKKVSFVGTEE 80 
52079432    1 MTIDEIYQMYMNDVYRFLLSMTKDKHLAEDLLQETFMRAYIHIHSYDHSKVKPWLFQVARNAFIDYVRKHKKEVTISDDM 80 
52784792    1 MTIDEIYQMYMNDVYRFLLSMTKDKHLAEDLLQETFMRAYIHIHSYDHSKVKPWLFQVARNAFIDYVRKHKKEVTISDDM 80 
305673652   1 MTIDEIYQMYMNDVYRFLLSMTKDKHLAEDLLQETFMRAYIHIHSYDHSKVKPWLFQVARNAFIDYVRKHKKEVTISDDL 80 
16078017    1 MTIDEIYQMYMNDVYRFLLSMTKDKHLAEDLLQETFMRAYIHIHSYDHSKVKPWLFQVARNAFIDYVRKHKKEVTISDDL 80 
30263235   81 LEAIQAgESTEEYVVAKNSYEKLIRIIHTLPVIEAQAVLLCDVHQLTYEEGASVLDLKLNTYKSHIFRGRKRLKQLLkeE 160
154685410  81 IGSLFQ-TAVQSPAHQIEIKEVLTGYMSELPDNYREALTLYYLKELNYKEASHIMNISEANFKSVLFRARQRLKALY--N 157
49186087   81 LEAIQAgESTEEYVVAKNSYEKLIRIIHTLPVIEAQAVLLCDVHQLTYEEGASVLDLKLNTYKSHIFRGRKRLKQLLkeE 160
47528609   81 LEAIQAgESTEEYVVAKNSYEKLIRIIHTLPVIEAQAVLLCDVHQLTYEEGASVLDLKLNTYKSHIFRGRKRLKQLLkeE 160
227813895  81 LEAIQAgESTEEYVVAKNSYEKLIRIIHTLPVIEAQAVLLCDVHQLTYEEGASVLDLKLNTYKSHIFRGRKRLKQLLkeE 160
229604117  81 LEAIQAgESTEEYVVAKNSYEKLIRIIHTLPVIEAQAVLLCDVHQLTYEEGASVLDLKLNTYKSHIFRGRKRLKQLLkeE 160
52079432   81 IGNLFQ-NAVQSPAHQVEIKEVLTLYMNQLPDNYREALTLYYLKELNYKEASSLMNISEANFKSVLFRARQRLKALY--N 157
52784792   81 IGNLFQ-NAVQSPAHQVEIKEVLTLYMNQLPDNYREALTLYYLKELNYKEASSLMNISEANFKSVLFRARQRLKALY--N 157
305673652  81 IGSLFQ-NAVQSPAHQVEIKEVLTGYMSELPDNYREALTLYYLKELNYKEASHIMNISEANFKSVLFRARQRLKALY--N 157
16078017   81 IGSLFQ-NAVQSPAHQVEIKEVLTGYMSELPDNYREALTLYYLKELNYKEASHIMNISEANFKSVLFRARQRLKALY--N 157
30263235  161 KSQNDK 166
154685410 158 RGVNDE 163
49186087  161 KSQNDK 166
47528609  161 KSQNDK 166
227813895 161 KSQNDK 166
229604117 161 KSQNDK 166
52079432  158 RGVNDE 163
52784792  158 RGVNDE 163
305673652 158 RGVNDE 163
16078017  158 RGVNDE 163
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap