Conserved Protein Domain Family
PRK09642

?
PRK09642: PRK09642 
RNA polymerase sigma factor
Statistics
?
PSSM-Id: 170031
View PSSM: PRK09642
Aligned: 19 rows
Threshold Bit Score: 161.036
Threshold Setting Gi: 30019875
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30261838    1 MQTYRHYIFQVIFSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKTWMARIATNHAIDYKRKKARENEELSLCKETEEN 80 
42780931    1 MQTYRHYIFQVIFSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKTWMARIATNHAIDYKRKKARENEELSLCKETEEN 80 
30019875    1 ------------------------------------------------MARIATNHAIDYKRKKARESEELSLCKEAEEN 32 
52143630    1 MQTYRHYIFQVIFSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKTWMARIATNHAIDYKRKKARENEELSLCKETEEN 80 
222095458   1 MQTYRHYIFQVIFSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKTWMARIATNHAIDYKRKKARENEELSLCKETEEN 80 
218235233   1 ------------------------------------------------MARIATNHAIDYKRKKARENEELSLCKETEEN 32 
217959319   1 MQTYRHYIFQVIFSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKTWMARIATNHAIDYKRKKARENEELSLCKETEEN 80 
301053373   1 MQTYRHYIFQVIFSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKTWMARIATNHAIDYKRKKARENEELSLCKETEEN 80 
296502433   1 ------------------------------------------------MARIATNHAIDYKRKKARESEELSLCKEAEEN 32 
163939640  22 VQTYHHYIFQVIFSILRHEEDAKDVTQEVFVKIHASLPNYQFRGLKTWMARIATNHAIDYKRKKARENEELSLCKETAEN 101
30261838   81 IKSSHNIEDLLLTKEQKLLIAQKLRELPENYRDVVLAHYLEEKSYQEIALQEKIEVKTVEMKLYRARKWIKKHWKEEEFL 160
42780931   81 IKSSQNIEDLLLTKEQKLLIAQKLRELPHNYRDVVLAHYLEEKSYHEIALQENIEVKTVEMKLYRARKWIKKHWKEEEFL 160
30019875   33 IKSSHNIEALLLTKEQKLLIAQKLRELPENYRDVVLAHYLEEKSYQEIALQENIEVKTVEMKLYRARKWIKKHWKEEEFL 112
52143630   81 IKSSHNIEDLLLTKEQKLLIAQKLRELPENYRDVVLAHYLEEKSYQEIALQENIEVKTVEMKLYRAKKWIKKHWKEEEFL 160
222095458  81 IKSSHNIEALLLTKEQKLLIAQKLRELPDNYRDVVLAHYLEEKSYQEIALQENIEVKTVEMKLYRARKWIKKHWKEEEFL 160
218235233  33 IKSSHNIEALLLTKEQKLLIAQKLRELPENYRDVVLAHYLEEKSYQEIALQENIEVKTVEMKLYRARKWIKKHWKEEEFL 112
217959319  81 IKSSHNIEALLLTKEQKLLIAQKLRELPDNYRDVVLAHYLEEKSYQEIALQENIEVKTVEMKLYRARKWIKKHWKEEEFL 160
301053373  81 IKSSHNIEDLLLTKEQKLLIAQKLRELPENYRDVVLAHYLEEKSYQEIALQEKIEVKTVEMKLYRARKWIKKHWKEEEFL 160
296502433  33 IKSSHNIEALLLTKEQKLLIAQKLRELPENYRDVVLAHYLEEKSYQEIALQENIEVKTVEMKLYRARKWIKKHWKEEEFL 112
163939640 102 IKSSHNIEALLLTKEQKLLIAQKLRELPDNYRDVVLAHYLEEKSYQEIALQENIEVKTVEMKLYRARKWIKKHWKEEEFL 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap