Conserved Protein Domain Family
PRK09630

?
PRK09630: PRK09630 
DNA topoisomerase IV subunit A; Provisional
Statistics
?
PSSM-Id: 170022
View PSSM: PRK09630
Aligned: 14 rows
Threshold Bit Score: 907.348
Threshold Setting Gi: 16752324
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15605393    1 MSDLSDLFKTHFTQYASYVILERAIPHVLDGLKPVQRRLLWTLFRMDDGKMHKVANIAGRTMALHPHGDAPIVEALVVLA 80 
76789400    1 MSDLSDLFKTHFTQYASYVILERAIPHVLDGLKPVQRRLLWTLFRMDDGKMHKVANIAGRTMALHPHGDAPIVEALVVLA 80 
166154877   1 MSDLSDLFKTHFTQYASYVILERAIPHVLDGLKPVQRRLLWTLFRMDDGKMHKVANIAGRTMALHPHGDAPIVEALVVLA 80 
237803090   1 MSDLSDLFKTHFTQYASYVILERAIPHVLDGLKPVQRRLLWTLFRMDDGKMHKVANIAGRTMALHPHGDAPIVEALVVLA 80 
237805011   1 MSNLSDLFKTHFTQYASYVILERAIPHVLDGLKPVQRRLLWTLFRMDDGKMHKVANIAGRTMALHPHGDAPIVEALVVLA 80 
62184673    1 MHDVSELFKTHFMHYASYVILERAIPHILDGLKPVQRRLLWTLFCMDDGKMHKVANIAGRTMALHPHGDAPIVEALVVLA 80 
89898786    1 MQDVSDLFKTHFMHYASYVILERAIPHILDGLKPVQRRLLWTLFRMDDGKMHKVANIAGRTMALHPHGDAPIVEALVVLA 80 
29839794    1 MHNVSDLFKTHFMHYASYVILERAIPHILDGLKPVQRRLLWTLFRMDDGKMHKVANIAGRTMALHPHGDAPIVEALVVLA 80 
16752324    1 MRDVSELFRTHFMHYASYVILERAIPHILDGLKPVQRRLLWTLFLMDDGKMHKVANIAGRTMALHPHGDAPIVEALVVLA 80 
15618626    1 MRDVSELFRTHFMHYASYVILERAIPHILDGLKPVQRRLLWTLFLMDDGKMHKVANIAGRTMALHPHGDAPIVEALVVLA 80 
15605393   81 NKGFLIETQGNFGNPLTGDPHAAARYIEARLSPLAKEVLFNTDLMTFHDSYDGREQEPDILAAKIPLLLLHGVDGIAVGM 160
76789400   81 NKGFLIETQGNFGNPLTGDPHAAARYIEARLSPLAKEVLFNTDLMTFHDSYDGREQEPDILAAKIPLLLLHGVDGIAVGM 160
166154877  81 NKGFLIETQGNFGNPLTGDPHAAARYIEARLSPLAKEVLFNTDLMTFHDSYDGREQEPDILAAKIPLLLLHGVDGIAVGM 160
237803090  81 NKGFLIETQGNFGNPLTGDPHAAARYIEARLSPLAKEVLFNTDLMTFHDSYDGREQEPDILAAKIPLLLLHGVDGIAVGM 160
237805011  81 NKGFLIETQGNFGNPLTGDPHAAARYIEARLSPLAKEVLFNTDLMTFHDSYDGREQEPDILAAKIPLLLLHGVDGIAVGM 160
62184673   81 NKGYLIDMQGNFGNPLTGDPHAAARYIEARLSPLAKEILFNTDLMSFHDSYDGRDKEPDILPAKLPLLLLHGVEGIAVGM 160
89898786   81 NKGYLIDTQGNFGNPLTGDPHAAARYIEARLSPLAKDILFNTDLMSFHDSYDGREKEPDILPAKLPLLLLHGVEGIAVGM 160
29839794   81 NKGYLIDMQGNFGNPLTGDPHAAARYIEARLSPLAKEILFNTDLMSFHDSYDGREKEPDILPAKLPLLLLHGVEGIAVGM 160
16752324   81 NKGYLIDTQGNFGNPLTGDPHAAARYIEARLSPLARETLFNTDLIAFHDSYDGREKEPDILPAKLPVLLLHGVDGIAVGM 160
15618626   81 NKGYLIDTQGNFGNPLTGDPHAAARYIEARLSPLARETLFNTDLIAFHDSYDGREKEPDILPAKLPVLLLHGVDGIAVGM 160
15605393  161 TTKIFPHNFCDLLEAQIAILNDQPFSLLPDFPPGGTMDASDYQDGLGSIVLRATIDIINDKTLLIKEICPSTTTETLIRS 240
76789400  161 TTKIFPHNFCDLLEAQIAILNDQPFSLLPDFPPGGTMDASDYQDGLGSIVLRATIDIINDKTLLIKEICPSTTTETLIRS 240
166154877 161 TTKIFPHNFCDLLEAQIAILNDQPFSLLPDFPSGGTMDASDYQDGLGSIVLRATIDIINDKTLLIKEICPSTTTETLIRS 240
237803090 161 TTKIFPHNFCDLLEAQIAILNDQPFSLLPDFPPGGTMDASDYQDGLGSIVLRATIDIINDKTLLIKEICPSTTTETLIRS 240
237805011 161 TTKIFPHNFCDLLEAQIAILNDQPFSLLPDFPPGGTMDASDYQDGLGSIVLRATIDIINDKTLLIKEICPSTTTETLIRS 240
62184673  161 TTKIFPHNLCELIEAQIAILNNRAFTLLPDFYSGGVMDASEYQDGLGSITMRASIQTVDQKTLIIKEICPSTTTETLIRS 240
89898786  161 TTKIFPHNLYELIEAQIAILNNRTFTLLPDFYSGGVMDASEYQDGLGSITIRASIQIVDSKTLIIKEICPSTTTETLIRS 240
29839794  161 TTKIFPHNLCELIAAQIAVLNNRAFTLLPDFYSGGVMDASEYQDGLGSITMRASIQIADQKTLIIKEICPSTTTETLIRS 240
16752324  161 TTKIFPHNFAELLKAQIAILNDKKFTVFPDFPSGGLMDPSEYQDGLGSITLRASIDIINDKTLVVKQICPQSTTETLIRS 240
15618626  161 TTKIFPHNFAELLKAQIAILNDKKFTVFPDFPSGGLMDPSEYQDGLGSITLRASIDIINDKTLVVKQICPQSTTETLIRS 240
15605393  241 IENAAKRGIIKIDSIQDFSTDLPHIEIKLPKGIYAKDLLRPLYTHTECQVILTSRPTAIYQGKPWETTISEILRLQTKTL 320
76789400  241 IENAAKRGIIKIDSIQDFSTDLPHIEIKLPKGIYAKDLLRPLYTHTECQVILTSRPTAIYQGKPWETTISEILRLQTKTL 320
166154877 241 IENAAKRGIIKIDSIQDFSTDLPHIEIKLPKGIHAKDLLRPLYTHTECQVILTSRPTAIYQGKPWETTISEILRLQTETL 320
237803090 241 IENAAKRGIIKIDSIQDFSTDLPHIEIKLPKGIYAKDLLRPLYTHTECQVILTSRPTAIYQGKPWETTISEILRLQTKTL 320
237805011 241 IENAAKRGIIKIDSIQDFSTDLPHIEIKLPKGIYAKDLLRPLYTHTECQVILTSRPTAIYQGKPWETTISEILRLQTKTL 320
62184673  241 IENAAKRGVIKIDSIQDFSTDQPHIEIKLPKGVYAKDIIEPLFQYTECQVVLTSRPTAIYNNKPVETSISEILKLHTEVL 320
89898786  241 IENAAKRGVIKIDSIQDFSTDQPHIEIKLPKGIYAKDILEPLFQYTECQVVLTSKPTAIYNNKPVETSISEILKLHTEAL 320
29839794  241 IENAAKRGVIKIDSIQDFSTDQPHIEIKLPKGVYAKDILETLFQHTECQVVLTSKPTAIYNNKPVETTISEILRLHTEVL 320
16752324  241 IENAAKRGTIKIDTIQDFSTDVPHIEIKLPKGSRAKEMLPLLFEHTECQVILYSKPTVIYENKPVECSISEILKLHTTAL 320
15618626  241 IENAAKRGTIKIDTIQDFSTDVPHIEIKLPKGSRAKEMLPLLFEHTECQVILYSKPTVIYENKPVECSISEILKLHTTAL 320
15605393  321 QNYLKKELLILEDSLSRELYHKTLEYLFIKHKLYDTVRSMLSKRKTSPSSSTIHNAVLEALTPFLDTLPAP-DKQATAQL 399
76789400  321 QNYLKKELLILEDSLSRELYHKTLEYLFIKHKLYDTVRSMLSKRKTSPSSSAIHNAVLEALTPFLDTLPAP-DKQATAQL 399
166154877 321 QNYLKKELLILEDSLSRELYHKTLECLFIKHKLYDTVRSMLSKRKTSPSSSAIHNAVLEALTPFLDTLPAP-DKQATAQL 399
237803090 321 QNYLKKELLILEDSLSRELYHKTLEYLFIKHKLYDTVRSMLSKRKTSPSSSAIHNAVLEALTPFLDTLPAP-DKQATAQL 399
237805011 321 QNYLKKELLILEDSLSRELYHKTLEYLFIKHKLYDTVRSMLSKRKTSPSSSAIHNAVLEALTPFLDTLPAP-DKQATAQL 399
62184673  321 EGYLQKELEILQDELAQEHYYKSLEYIFIKYRLYDTVRANLSKLKNTVSQEDLHAAVLTALAPFLSSLPTIpSKQATGQL 400
89898786  321 EGYLQKELQILHDELAQEHYYKSLEYIFIKHRLYDIVRELLSKLGNKVSQEDLHEAVLASLAPFISSLPEApCKQATSQL 400
29839794  321 EGYLQKELQILHDELSQEHYYKSLEYIFIKHRLYDTVRENLSKLGNKVSQEDLHEAVLSSLSPFLASLPETpNKEATGQL 400
16752324  321 QGYLEKELLLLQEQLTLDHYHKTLEYIFIKHKLYDSVREVLA-INKKISADDLHQAVLHALEPWLHELATPvTKQDTSQL 399
15618626  321 QGYLEKELLLLQEQLTLDHYHKTLEYIFIKHKLYDSVREVLA-INKKISADDLHQAVLHALEPWLHELATPvTKQDTSQL 399
15605393  400 AALTIKKILCFDENSYEKELACLEKKRSSVQKDLSQLKKYTVLYIKKLLETYRQLGHRKTKIAKFddlptervsahkKAK 479
76789400  400 AALTIKKILCFDENSYEKELACLEKKRSSVQKDLSQLKKYTVLYIKKLLETYRQLGHRKTKIAKFddlpterisahkKAK 479
166154877 400 AALTIKKILCFDENSYEKELACLEKKRSSVQKDLSQLKKYTVLYIKKLLETYRQLGHRKTKIAKFddlptervsahkKAK 479
237803090 400 AALTIKKILCFDENSYEKELACLEKKRSSVQKDLSQLKKYTVLYIKKLLETYRQLGHRKTKIAKFddlpterisahkKAK 479
237805011 400 AALTIKKILCFDENSYEKELACLEKKRSSVQKDLSQLKKYTVLYIKKLLETYRQLGHRKTKIAKFddlpterisahkKAK 479
62184673  401 ASLAIKKILCFNENRYTKDLAAIEKKQAAVNKDLSNMKKFTIKYLKGLSAKYGELGKRKTQVLSF------------SKQ 468
89898786  401 ASLAIKKILCFNETSYTKDLEGIKKKQTAVKKDLSNMKKFTIKYLKGLLAKYGELGKRKTQILSF------------SNQ 468
29839794  401 ASLAIKKILCFNESHYTKDLAKIEKKQAAVEKDLNNMKKFTIKYLKGLLAKYGELGKRKTQVLSF------------SKQ 468
16752324  400 ASLTIKKILCFNEEACTKELLAIEKKQAAIQKDLGRIKEVTVKYLKGLLERHGHLGERKTQITNF------------KTA 467
15618626  400 ASLTIKKILCFNEEACTKELLAIEKKQAAIQKDLGRIKEVTVKYLKGLLERHGHLGERKTQITNF------------KTA 467
15605393  480 ELAALDQEENF 490
76789400  480 ELAALDQEENF 490
166154877 480 ELAALDQEENF 490
237803090 480 ELAALDQEENF 490
237805011 480 ELAALDQEENF 490
62184673  469 KKSILKQQTLV 479
89898786  469 KKSVLKQQTLV 479
29839794  469 KKSVLKQQALV 479
16752324  468 KTSILKQQTLI 478
15618626  468 KTSILKQQTLI 478
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap