Conserved Protein Domain Family
porD

?
PRK09624: porD 
pyruvate ferredoxin oxidoreductase subunit delta; Reviewed
Statistics
?
PSSM-Id: 170017
View PSSM: PRK09624
Aligned: 7 rows
Threshold Bit Score: 210.655
Threshold Setting Gi: 242399356
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18977339    1 MAESPFKADIERAQKELSEKMTPGAIVYIPGSSVINKTGSWRVFKPEFNRDKCVRCYLCYIYCPEPAIYLDEEGYPVFDY 80 
14521563    1 MAESPFKADIERAQKELTEKMTPGAIAYIPGSSVINKTGSWRVFRPEFKKDKCVRCFLCYIYCPEPAIYLDEEGYPVFDY 80 
14590564    4 MAESPFKADIERAQKELTEKMTPGAIAYIPGSSVINKTGSWRVFKPEFHKDKCVRCFLCYIYCPEPAIYLDEEGYPVFDY 83 
242399356   1 MAENPFKADIEKVQKEYSEKMTTGAIVYIPGSSVVNKTGGWRVFMPKFDKDKCIRCFICYTLCPEPAIYLDEESYPVFDY 80 
240102321   1 MAESPFKADIERVQKEYSEKMTPGAIAYIPGSSVINKTGSWRVFMPEFYRDKCVRCYLCYIYCPEPAIYLDEENYPVFDY 80 
57641917    1 MAESPFKADIERVQKEYSEKMTPGAIAYIPGSSVINKTGSWRVFMPEFNRDKCTRCYLCYIYCPEPAIYLDEEGYPVFDY 80 
212224631   1 MAESPFKADIERVQKEYSEKMTPGAIVYLPGSSVVNKTGSWRVFMPEFNRDKCVRCYLCYIYCPEPAIYLDDENYPVFDY 80 
18977339   81 DYCKGCGICANECPTKAIEMVREVK 105
14521563   81 DYCKGCGICANECPTNAIEMVREVK 105
14590564   84 DYCKGCGICANECPTKAIEMVREVK 108
242399356  81 DYCKGCGICANECPTKAIEMVRETK 105
240102321  81 DYCKGCGICANECPTDAIVMVRESK 105
57641917   81 DYCKGCGICANECPVDAIVMVRETK 105
212224631  81 DYCKGCGICANECPTEAIVMVRETK 105
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap