Conserved Protein Domain Family
vorD

?
PRK09623: vorD 
3-methyl-2-oxobutanoate dehydrogenase subunit delta
Statistics
?
PSSM-Id: 170016
View PSSM: PRK09623
Aligned: 7 rows
Threshold Bit Score: 202.869
Threshold Setting Gi: 212224628
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18977342    1 MNTLFGKTKEEAKPIVLKSVDEYPEAPISLGTTLVNPTGDWRTFKPVVNEEKCVKCYICWKYCPEPAIYIKPDGYVAIDY 80 
14521566    1 MNTLFGKAKEEARVISPKSVDEYPEAPITLGTTLVNFTGDWRTFMPVIDESKCVKCYICWKFCPEPAIYIKEDGFVAIDY 80 
14590561    1 MNTLFGKAKEEAKPITPKSVDEYPEAPVSLGITLVNFTGDWRTFMPVIDESKCVKCYICWKYCPEPAIYIKEDGFVAIDY 80 
242399359   1 MNTLFREKKANAKKIMFKSIDEYPEAPITLGTTLSNFTGDWRNFMPVVDESKCIKCYICWKFCPEPAIYIKEDGYVAVDY 80 
240102324   1 MNTLFGEKKTEAKKIVFTSVDQYPEAPISLATTLSNFTGDWRTFIPVIIEEKCVKCYICWKFCPEPAIYIREDGYVGIDY 80 
57641914    1 MNTLFGEKKAEAKKIVLTSVDQYPEAPISLGTTLSNFTGDWRTFIPVVNEDKCVKCYICWKFCPEPAIYIKPDGYVAIDY 80 
212224628   1 ---MFGEKKEGATKIVLKSVDEYPEAPITLGTTLINFTGDWRTFIPVVDDNKCVKCYICWKFCPEPAIYIREDGYVGIDY 77 
18977342   81 DYCKGCGICANECPTKAITMIKEEK 105
14521566   81 DYCKGCGICANECPTKAITMVREEK 105
14590561   81 DYCKGCGICANECPTKAITMVREEK 105
242399359  81 DYCKGCGICANECPTKAISMVREEK 105
240102324  81 DYCKGCGICANECPTNAITMEKEEK 105
57641914   81 DYCKGCGICANECPTKAITMEKEEK 105
212224628  78 DYCKGCGICANECPTKAITMEKEEK 102
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap