Conserved Protein Domain Family
PRK09579

?
PRK09579: PRK09579 
multidrug efflux RND transporter permease subunit
Statistics
?
PSSM-Id: 169983
View PSSM: PRK09579
Aligned: 14 rows
Threshold Bit Score: 1725.07
Threshold Setting Gi: 229592364
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
229592364    1 MTITDLFIRRPVLALVVSLLIVLLGWQAYGKLPLRQFPQMESALITVTTVSPGSSAESVQSYITQPLQKSLASAQGIDYM 80  
116052409    1 MAFTDPFIRRPVLASVVSLLIVLLGMQAFSKLVIREYPQMENALITVTTLYAGANAETIQGYITQPLQQSLASAEGIDYM 80  
15599571     1 MAFTDPFIRRPVLASVVSLLIVLLGMQAFSKLVIREYPQMENALITVTTLYAGANAETIQGYITQPLQQSLASAEGIDYM 80  
152986594    1 MAFTDPFIRRPVLACVVSLLIVLLGMQAFSKLVIREYPQMENALITVTTLYAGANAETIQGYITQPLQQSLASAEGIDYM 80  
218893466    1 MAFTDPFIRRPVLASVVSLLIVLLGMQAFSKLVIREYPQMENALITVTTLYAGANAETIQGYITQPLQQSLASAEGIDYM 80  
77460714     1 MAFTDPFIRRPVLATVVSLLIVLLGFQAWSKLPLRQYPQMENALITVTTAYPGANAETIQGYITQPMQQSLASAEGIDYM 80  
146306240    1 MAFTDPFIRRPVLATVVSLLIVLLGFQAFSKLSIRQYPQMENALITVTTAYPGANAETIQGYITQPLQQSLASAEGIDYM 80  
148546188    1 MAFTDPFIRRPVLASVVSLLILLLGFQAWNKLQIRQYPQMENALITVTTAYPGANAETIQGYITQPLQQSLASAEGIDYM 80  
170720160    1 MAFTDPFIRRPVLASVVSLLILLLGFQAWNKLQIRQYPQMENALITVTTAYPGANAETIQGYITQPLQQSLASAEGIDYM 80  
146283470    1 -------------------------------------------------------------------------------M 1   
229592364   81 KSSSRQNISIISIYGRVGADSDRLFTELLAKTNEVRNQLPREIDDPILSKVAADNTALMYLSFSSEIMNNAQITDYLSRV 160 
116052409   81 TSVSRQNYSTISIYARIGANTDRLVTELLAKSNEVKSQLPPDAEDPVLQKEAADASALMYISFYSEQMNNPQITDYLSRV 160 
15599571    81 TSVSRQNYSTISIYARIGANTDRLVTELLAKSNEVKSQLPPDAEDPVLQKEAADASALMYISFYSEQMNNPQITDYLSRV 160 
152986594   81 TSVSRQNYSTISIYARIGANTDRLVTELLAKSNEVKSQLPPDAEDPVLQKEAADASALMYISFYSEQMNNPQITDYLSRV 160 
218893466   81 TSVSRQNYSTISIYARIGANTDRLVTELLAKSNEVKSQLPPDAEDPVLQKEAADASALMYISFYSEQMNNPQITDYLSRV 160 
77460714    81 TSVSRQNFSVISIYARIGSNSDRLFTELLAKANEVKNKLPQDAEDPVLSKEAADASALMYISFFSKELNNPQITDYLSRV 160 
146306240   81 TSSSQQNLSTISIYAHIGADTDRLFTELLAKANEVKNQLPQDAEDPVLSKEAADASALMYVSFYSDELSNPQITDYLSRV 160 
148546188   81 TSVSRQNFSIISIYARVGADSDRLFTELLAKANEVRNKLPQDSEDPVLSKEAADASALMYVSFYSKEMSNPQITDYLSRV 160 
170720160   81 TSVSRQNFSIISIYARIGADSDRLFTELLAKANEVRNQLPQDAEDPVLSKEAADASALMYISFYSKEMSNPQITDYLSRV 160 
146283470    2 TSVSQQNASVISVYARIGADTDRLYTELLSQANSVKNQLPQDAEDPVLNKQAADSTALMYISFYSDQLSNPQITDYLSRV 81  
229592364  161 IQPRLVTLPGMAEAQIIGNQSFAMRLWLDPIKLAGFGLSASEVTQAIKRYNVQPTAGDVTGEYVVTSIQTNTELHSVEGF 240 
116052409  161 IQPKLATLPGIAEAEILGNQVFAMRLWLDPVKMAAFGVTAGEINQAVQQYNFLAAAGEVKGQLVVTSVNASTDLKSPQAF 240 
15599571   161 IQPKLATLPGIAEAEILGNQVFAMRLWLDPVKMAAFGVTAGEINQAVQQYNFLAAAGEVKGQLVVTSVNASTDLKSPQAF 240 
152986594  161 IQPKLATLPGIAEAEILGNQVFAMRLWLDPVKMAAFGVTAGEINQAVRQYNFLAAAGEVKGQLVVTSVNASTDLKSPQAF 240 
218893466  161 IQPKLATLPGIAEAEILGNQVFAMRLWLDPVKMAAFGVTAGEINQAVQQYNFLAAAGEVKGQLVVTSVNASTDLKSPQAF 240 
77460714   161 IQPKLATLPGMAEAEILGNQVFAMRLWIDPVKLAGFGLSASDVTNAVRQYNFLSAAGEVKGEYVVTSINANTELKSAEAF 240 
146306240  161 IQPKLATLPGMAEAQILGNQVFAMRLWLDPVKMAAYGITAGDLNSAVRKYNFLSAAGEVKGQYVVTSINASTDLKSAEAF 240 
148546188  161 IQPKLATLPGMAEAEILGNQVFAMRLWLDPVKLAGFGLSATDVTNAVRRYNFLSAAGEVKGEYVVTSVNASTELKSAEAF 240 
170720160  161 IQPKLATLPGMAEAEILGNQVFAMRIWIDPVKLAAFGLAATDVTSAVRRYNFLAAAGEVKGEYVVTSINANTELKSAEAF 240 
146283470   82 IQPKLATLPGMAEAEILGNQVFAMRLWLDPVKLAAYGVSAGDVNEAVRKYNFLSAAGEVKGQYVVTSINADTELKTPEAF 161 
229592364  241 NAIPLKTKGDSQVRLGDVARVELGSQNYDSFSTFNGIPALYISIKPAPDANPLELAKHVRELLPQLQSQIPPGLDVDIAY 320 
116052409  241 AAIPVKTDGDRRVLMGDVARVELGAASYDAISSFNGIPSVYIGIKGTPSANPLDVIKEVRAKMPELEEQLPPNLKVSIAY 320 
15599571   241 AAIPVKTDGDRRVLMGDVARVELGAASYDAISSFNGIPSVYIGIKGTPSANPLDVIKEVRAKMPELEEQLPPNLKVSIAY 320 
152986594  241 AAIPVKTDGDRRVLMGDVARVELGAASYDAISSFNGIPSVYIGIKGTPSANPLDVIKEVRAKMPELEEQLPPNLKVSIAY 320 
218893466  241 AAIPVKTDGDRRVLMGDVARVELGAASYDAISSFNGIPSVYIGIKGTPSANPLDVIKEVRAKMPELEEQLPPNLKVSIAY 320 
77460714   241 GKIPLKVSGDSRVLLSDVARVEMGAENYNSISSFGGTPSVYIGIKATPGANPLDVIKEVRKIMPELEAQLPPNLKSEIAY 320 
146306240  241 GAIPVKTLGDTRVLVRDIARVEMGAENYDSISSFDGIPSVYIAIKGTPSANPLDVIKEVRGILPELEAQLPPNLKVAIAY 320 
148546188  241 AALPLKTSGDSRVLLGDVARVEMGAENYDTVSSFDGTPSVYIGIKATPAANPLDVIKEVRRIMPELESQLPSALKVSIAY 320 
170720160  241 AALPLKTSGDSRVLLGDVARVEMGAENYDTVSSFDGTPSVYIGIKATPAANPLEVIKEVRRIMPELESQLPSALKGSIAY 320 
146283470  162 AAIPLKTQGDSRVLLGDVARVEMGAESYNSISSFDGIPSVYIGIKGTPSANPLDVIKEVRAIMPQIEAQLPPGLKATIAY 241 
229592364  321 DSTLYINASIDQVLSSLVEAIVIVVLVVFLFLGSLRSAVIPVVTIPLSLIGTLFFMQVMGYSINVLTLLAMVLAIGLVVD 400 
116052409  321 DATRFIQASIDEVVKTLGEAVLIVIVVVFLFLGAFRSVLIPVVTIPLSMIGVLFFMQAMGYSINLLTLLAMVLAIGLVVD 400 
15599571   321 DATRFIQASIDEVVKTLGEAVLIVIVVVFLFLGAFRSVLIPVVTIPLSMIGVLFFMQAMGYSINLLTLLAMVLAIGLVVD 400 
152986594  321 DATRFIQASIDEVVKTLGEAVLIVIVVVFLFLGAFRSVLIPVVTIPLSMIGVLFFMQAMGYSINLLTLLAMVLAIGLVVD 400 
218893466  321 DATRFIQASIDEVVKTLGEAVLIVIVVVFLFLGAFRSVLIPVVTIPLSMIGVLFFMQAMGYSINLLTLLAMVLAIGLVVD 400 
77460714   321 DATLFIQASIDEVVKTLFEAVLIVIVVVFLFLGALRSVVIPVVTIPLSMIGVMFFMQMMGYSINLLTLLAMVLAIGLVVD 400 
146306240  321 DATLFIQASIDEVVKTLVEAVLIVIVVVFLFLGAFRSVLIPVITIPLSMIGVLFFMQLMGYSINLLTLLAMVLAIGLVVD 400 
148546188  321 DATRFIQASIDEVIKTLGEAVLIVIVVVFLFLGALRSVLIPVVTIPLSMIGVLFFMQMMGYSLNLLTLLAMVLAIGLVVD 400 
170720160  321 DATLFIQASIDEVVKTLGEAVLIVIVVVFLFLGALRSVLIPVVTIPLSMIGVLFFMQMMGYSLNLLTLLAMVLAIGLVVD 400 
146283470  242 DATEFIQASIDEVVKTLAEAAVIVIVVVFLFLGSLRTVLIPVVTIPLSMIGVLFFMQAMGYSINLLTLLAMVLAIGLVVD 321 
229592364  401 DAIVVMENIHRHIERGKSPLEAAIRGAREICVPVLSMTITLAAVYTPIGFLQGLTGALFKEFALTLAGAVVISGIVALTL 480 
116052409  401 DAIVVVENIHRHIEEGKPPFEAALEGAREIAVPVVSMTITLAAVYAPIGFLTGLTGALFKEFAFTLAGAVIISGIVALTL 480 
15599571   401 DAIVVVENIHRHIEEGKPPFEAALEGAREIAVPVVSMTITLAAVYAPIGFLTGLTGALFKEFAFTLAGAVIISGIVALTL 480 
152986594  401 DAIVVVENIHRHIEEGKTPFDAALEGAREIAIPVVSMTITLAAVYAPIGFLTGLTGALFKEFAFTLAGAVIISGIVALTL 480 
218893466  401 DAIVVVENIHRHIEEGKPPFEAALEGAREIAVPVVSMTITLAAVYAPIGFLTGLTGALFKEFAFTLAGAVIISGIVALTL 480 
77460714   401 DAIVVVENIHRHIEEGKTPLEAALEGAREIAMPVVSMTITLAAVYAPIGFLTGLTGALFKEFALTLAGAVVISGVVALTL 480 
146306240  401 DAIVVVENIHRHIEEGKTPFDAAIEGAREIAVPVVSMTITLAAVYAPIGFLEGLTGALFKEFALTLAGAVIISGIVALTL 480 
148546188  401 DAIVVVENIHRHMEEGKSPFDAALEGAREIAMPVVSMTITLAAVYAPIGFLTGLTGALFKEFALTLAGAVVISGIVALTL 480 
170720160  401 DAIVVVENIHRHMEEGKSPLDAALEGAREIAMPVVSMTITLAAVYAPIGFLTGLTGALFKEFALTLAGAVIISGVVALTL 480 
146283470  322 DAIVVVENIHRHIEQGKSPFQAALDGAREIAMPVVSMTITLAAVYAPIGFLQGLTGALFQEFALTLAGAVLISGVVALTL 401 
229592364  481 SPMMCAVLLRPEEQPKGLFLILDRFFNALRKSYQQRLHQIMKAQSVVLVFALVVLGLIPVMLIFTLSELAPDEDKGLIFI 560 
116052409  481 SPMMCSRLLRHEENPSGLAHRLDLIFEGLKRRYQRALHGTLDTRPVVLVFAVLVLALIPVLLMFTKKELAPEEDQGIVFL 560 
15599571   481 SPMMCSRLLRHEENPSGLAHRLDLIFEGLKQRYQRALHGTLDTRPVVLVFAVLVLALIPVLLMFTKKELAPEEDQGIVFL 560 
152986594  481 SPMMCSRLLRHEENPSGLAHRLDLLFEGLKRRYQRALHGTLETRPVVLVFAVLVLALIPLLLMFTKKELAPEEDQGIVFL 560 
218893466  481 SPMMCSRLLRHEENPSGLAHRLDLIFEGLKQRYQRALHGTLDTRPVVLVFAVLVLALIPVLLMFTKKELAPEEDQGIVFL 560 
77460714   481 SPMMCAMLLRHDENPTGLAHRLDRIFDSLKRRYQRMLHGTLNTRPVVLVFAVIVLCLIPVLLKFTKSELAPDEDQGIIFM 560 
146306240  481 SPMMCAKLLRHDENPSGLAHRLDMIFDRLKQRYQKMLHGTLNTRPVVVVFGVIVMALIPVLLSFTESELAPEEDQGVVFL 560 
148546188  481 SPMMCALLLRREQNPSGLAHRLDQLFERLKGRYQRVLHATLDSRPVVLVFAVIILCLIPVLLKFTQNELAPNEDQGVIFM 560 
170720160  481 SPMMCALLLRREHNASGLAHRLDVLFERIKGRYQRLLHSTLNSRPVVLVFAVIILCLIPVLLKFTQNELAPNEDQGVIFM 560 
146283470  402 SPMMCSKLLRHEENPSGFAHRLDELFERLKQRYQHALHGTLNTRPVVLVFAVLVLALIPVLLMFTESELAPEEDQGIVFM 481 
229592364  561 LSSAPQPTNLAYLNTYTQAFIEPFKTLPEYQASFQINGLDGVHSGVGGFLLKPWNERDRTQMQVLAPLREKLDRIPGLQV 640 
116052409  561 MTNSPQTANLDYLNRYTAEFEGIFRSFPEYYSAFQINGYNGVQAGIGGMLLKPWDEREKSQMELLHAVQAKLNEIPGVQI 640 
15599571   561 MTNSPQTANLDYLNRYTAEFEGIFRSFPEYYSAFQINGYNGVQAGIGGMLLKPWDEREKSQMELLHAVQAKLNEIPGVQI 640 
152986594  561 MTSSPQTANLDYLNRYTAEFEGIFRSFPEYYSAFQINGYNGVQAGIGGMLLKPWDEREKSQMELLHAVQARLNEIPGVQI 640 
218893466  561 MTNSPQTANLDYLNRYTAEFEGIFRSFPEYYSAFQINGYNGVQAGIGGMLLKPWDEREKSQMELLHAVQAKLNEIPGVQI 640 
77460714   561 MANAPQPTNLDYLNTYTDEFIKIFKEFPEYYSSFQINGYNGVQSGIGGFLLKPWNERSRTQMEILPEVQGKLEGIPGLQI 640 
146306240  561 FANAPQPTNLDYVNAYTDQFVEIFKSFPEYYSSFQINGFDGVQSGIGGFLLTPWNDRERTQMEILPEVQARLNHIPGLQI 640 
148546188  561 MSSSPQPANLDYLNAYTDQFTPLFKAFPEYYSSFQINGFNGVQTGIGGFLLKPWNERERTQMELLPLVQAKLEEISGLQI 640 
170720160  561 ISSSPQPANLDYLNAYTDQFTPLFKAFPEYYSSFQINGFSGVQSGIGGFLLKPWNERDRTQMELLPLVQAKLDNISGLQI 640 
146283470  482 MASAPKTANLDYLNAYTDQFLEIFKSFPEYYSWFQINGFDGVQSGIGGFLLKPWDERERSQMEILPEVQAKLDRLPGLQI 561 
229592364  641 FAFNLPSLPGGGEGLPFGFVLSSQQDYESMMSVAERIKQRAIDSGKFAYVDIDLAFDRPEVVIDIDRTKAAQMGVSMEEL 720 
116052409  641 FAFNLPSLPGTGEGLPFQFVLNTANDYESLLQVAQRVKQRASESGKFAFLDLDLAFDKPELVVDIDREKAAQMGVSMQDL 720 
15599571   641 FAFNLPSLPGTGEGLPFQFVLNTANDYESLLQVAQRVKQRASESGKFAFLDLDLAFDKPELVVDIDREKAAQMGVSMQDL 720 
152986594  641 FAFNLPSLPGTGEGLPFQFVLNTANDYESLLQVAQRVKQRATESGKFAFLDLDLAFDKPELVVDIDREKAAQMGVSMQDL 720 
218893466  641 FAFNLPSLPGTGEGLPFQFVLNTANDYESLLQVAQRVKQRASESGKFAFLDLDLAFDKPELVVDIDREKAAQMGVSMQDL 720 
77460714   641 FGFNLPSLPGTGEGLPFEFVINTANDYELLLQVADRIKKRAMESGKFAFVDLDLAFDKPEVVVDIDRAKAAQMGVSMQDL 720 
146306240  641 FGFNLPSLPGTGEGLPFQFVVNTPNDYESLLQVAERVKARALESGKFAFLNIDLAFDKPEIVVDIDRAKAAQMGVSMEDL 720 
148546188  641 FGFNLPSLPGTGEGLPFQFVINTAGDYPALLDVAQRIKTRAQASGKFAFLDIDLAFDKPEVVVDIDRAKAAQMGVSMDTL 720 
170720160  641 FGFNLPSLPGTGEGLPFQFVINTAGGYPALLEVAQRVKERAQASGKFAFLDIDLAFDKPEVVVDIDRAKAAQMGVSMDVL 720 
146283470  562 FGFNLPSLPGTGEGLPFQFVINTANDYETLLQVTERIRKRAEESGKFAFLDVDLAFDKPEIVVEIDREKAAQMGVSMEDL 641 
229592364  721 SLTLATLLAETEINRFSIDGHLYKVIAQVERTYRDNPQWLSHYAVKNADGQLLPLSTLIKVsSQQVRPRQLNQFQQLNSV 800 
116052409  721 GVALASLLGEGEINRFTIDGRSYKVIAQVERPYRDNPGWLGSYYVKSRNGQLVALSTLIET-HERARPRQLNQFQQLNSA 799 
15599571   721 GVALASLLGEGEINRFTIDGRSYKVIAQVERPYRDNPGWLGSYYVKSRNGQLVALSTLIET-HERARPRQLNQFQQLNSA 799 
152986594  721 GVALASLLGEGEINRFTIDGRSYKVIAQVERPYRDNPGWLGSYYVKSSDGQLVALSTLIET-RERARPRQLNQFQQLNSA 799 
218893466  721 GVALASLLGEGEINRFTIDGRSYKVIAQVERPYRDNPGWLGSYYVKSRNGQLVALSTLIET-HERARPRQLNQFQQLNSA 799 
77460714   721 GGTLATLLGEAEINRFTIEGRSYKVIAQVERAYRDNPDWLNNYYVKNTQGELLPLSTLITV-TDRARPRQLNQFQQLNAA 799 
146306240  721 GATLASLLGEGEINRFTIDGRSYKVIAQVERAYRDNPGWLDNYHVRSESGAMVPLGTLISL-SDRARPTKLKQFQQLNSA 799 
148546188  721 GGTLATLLGEAEINRFTLEGRSYKVIAQVERPYRDNPGWLNNYYVKNEQGQLLPLSTLITL-TDRARPRQLNQFQQLNAA 799 
170720160  721 GGTLATLLGEGEINRFTLEGRSYKVIAQVERPYRDNAGWLNSYYVKNDQGQLLPLSTLITL-SDRARPRQLNQFQQLNSA 799 
146283470  642 GLTLSTLLGEGEINRFTIEGRSYKVIAQVERAYRDNPDWLSNYYVRNQQGQMLPLSTLIKV-RDRARPTQLKQFQQLNAA 720 
229592364  801 IVSGFPIVGMSHALETLQAIAQEEAPPGYTFDYSNATRQFVQEGNALWGTFGLALAIIGLVLAAQFESLRDSLVILVTVP 880 
116052409  800 IISGFPIVSMGEAIETVQQIAREEAPRGFAVDYAGASRQYVQEGSALLVTFGLALAIIFLVLAAQFESFRDPLVIMVTVP 879 
15599571   800 IISGFPIVSMGEAIETVQQIAREEAPRGFAVDYAGASRQYVQEGSALLVTFGLALAIIFLVLAAQFESFRDPLVIMVTVP 879 
152986594  800 IISGFPIVSMGEAIETVQQIAREEAPRGFAVDYAGASRQYVQEGNALLVTFGLALAIIFLVLAAQFESFRDPLVIMVTVP 879 
218893466  800 IISGFPIVSMGEAIETVQQIAREEAPRGFAVDYAGASRQYVQEGSALLVTFGLALAIIFLVLAAQFESFRDPLVIMVTVP 879 
77460714   800 KLSGFPLVSMGEAIDSVLQIAREEAPAGFAFDYGGASRQFVQEGSALWVTFALALAIIFLVLAAQFESFRDPLVILVTVP 879 
146306240  800 IIEGVPIVSQGEAIDTITAIAREEAPRGYSFDYAGASRQYIQEGSALFVTFALALAIIFLVLAAQFESFRDPLVILVTVP 879 
148546188  800 IIQGVPMVSLGEALKTVQDIAREEAPEGFAFDYAGVARQYVQEGSALWVTFGLALAIIFLVLAAQFESFRDPLVILVTVP 879 
170720160  800 IIQGVPLVSIGEALQTVRDIAAEQAPEGFSFDYAGAARQYIQEGSALWVTFGLALAIIFLVLAAQFESFRDPLVILVTVP 879 
146283470  721 MIQGFPIVSMGEAIETLQTIAREEAPEGFSFDYAGASRQYVQEGNALYLTFALALAVIFLVLAAQFESFRDPLVILVTVP 800 
229592364  881 LSIAGALIALFLGWSTLNIYTQIGLVTLIGLISKHGILIVEFANQLRKEQGLSPRAAVEEAAAIRLRPILMTTLATVLGV 960 
116052409  880 LSICGALIPLFLGVSSLNIYTQVGLVTLIGLISKHGILIVEFANQLRHEQGLGRREAIEQAAAIRLRPVLMTTAAMVLGV 959 
15599571   880 LSICGALIPLFLGVSSLNIYTQVGLVTLIGLISKHGILIVEFANQLRHEQGLGRREAIEQAAAIRLRPVLMTTAAMVLGV 959 
152986594  880 LSICGALVPLFLGVSSLNIYTQVGLVTLIGLISKHGILIVEFANQLRHEQGLGRREAIEQAAAIRLRPVLMTTAAMVLGV 959 
218893466  880 LSICGALIPLFLGVSSLNIYTQVGLVTLIGLISKHGILIVEFANQLRHEQGLGRREAIEQAAAIRLRPVLMTTAAMVLGV 959 
77460714   880 LSICGALIPLFLGWSSMNIYTQVGLVTLIGLISKHGILIVEFANQLRKDKGLTPREAVEEAAAIRLRPVLMTTAAMVFGM 959 
146306240  880 LSICGALVPIFLGFSTMNIYTQVGLVTLIGLISKHGILIVEFANQLRHEKGLPLREAIEEAAAIRLRPVLMTTAAMVFGM 959 
148546188  880 LSICGALLPLFLGVSSMNIYTQVGLVTLIGLISKHGILIVEFANQLRDERGLSVREAIEEAAAIRLRPVLMTTAAMVFGM 959 
170720160  880 LSICGALLPLFLGVSSMNIYTQVGLVTLIGLISKHGILIVEFANQLREEKGLSARDAIEEAAAIRLRPVLMTTAAMVFGM 959 
146283470  801 LSVCGALVPLFLGLSSMNIYTQVGLVTLIGLISKHGIMIVEFANQLRRERGLSRREAVEEAAAIRLRPVLMTTAATVFGM 880 
229592364  961 IPLILSSGAGAVSRFDIGLVIATGMSIGTLFTLFVLPSVYAALTKADPAARTVGSTSS 1018
116052409  960 IPLILATGAGAVSRFDIGIVIATGMSVGTLFTLFVLPCIYTLVARPDAPPGVTQAANA 1017
15599571   960 IPLILATGAGAVSRFDIGIVIATGMSVGTLFTLFVLPCIYTLVARPDAPPGVTQAANA 1017
152986594  960 IPLILASGAGAVSRFDIGIVIATGMSVGTLFTLFVLPCIYTLVARPDAPPGVTQAAGA 1017
218893466  960 IPLILATGAGAVSRFDIGIVIATGMSVGTLFTLFVLPCIYTLVARPDAPPGVTQAANA 1017
77460714   960 VPLIVATGAGAVSRFDIGTVIATGMSIGTLFTLFVLPCVYTVLAKPDPRE-------- 1009
146306240  960 VPLILASGAGAVSRFDIGLVIATGMSVGTLFTLFVLPCVYSLLAKPDAEPQAQAVPVH 1017
148546188  960 VPLILATGAGAVSRFDIGMVIATGMSIGTLFTLFVLPCVYTLLAHKASAKAPAIA--- 1014
170720160  960 VPLILATGAGAVSRFDIGTVIATGMSIGTLFTLFVLPCIYTLLAHKTAPTEPVVA--- 1014
146283470  881 VPLIIASGAGAVSRFDIGLVIATGMSVGTLFTLFVLPAVYELLARPDKAPQQAAEPGI 938 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap