Conserved Protein Domain Family
PRK09578

?
PRK09578: PRK09578 
MexX/AxyX family multidrug efflux RND transporter periplasmic adaptor subunit
Statistics
?
PSSM-Id: 169982
View PSSM: PRK09578
Aligned: 26 rows
Threshold Bit Score: 569.811
Threshold Setting Gi: 83720471
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30249102    1 MLRYPNRFYILMVLFSIYGLSGCNDRQSDTAANEVpPQVDVIITRVVSSPVSIELPGRLEAFRQAEVRARVAGIVTERLY 80 
116054397   3 IQWTGSLRGLLAALVALFLLGCEEAADTGKTAEAP-AEVGVIVARPAPIGITSELPGRLEAYRQAEVRARVAGIVTRRLY 81 
15597215    3 IQWTGSLRGLLAALVALFLLGCEEAADAGKTAEAP-AEVGVIVARPAPIGITSELPGRLEAYRQAEVRARVAGIVTRRLY 81 
152986788   3 IQWTGSLRGLLATLVALFLLGCDKAPEAEKATDAP-AEVGVIVAKPAPIGITSELPGRLEAYRQAEVRARVAGIVTRRLY 81 
218892023   3 IQWTGSLRGLLAALVALFLLGCEEAADAGKTAEAP-AEVGVIVARPAPIGITSELPGRLEAYRQAEVRARVAGIVTRRLY 81 
161524789   3 DKRSLSRRLTPLALALAVAAAGCGKGKPDAEPPAV-QKATVVTVRPVAVPMTVELPGRLDAYRRAEVRARVAGIVTARTY 81 
189350457   3 DKRSLSRRLTPLALALAVAAAGCGKGKPDAEPPAV-QKATVVTVRPVAVPMTVELPGRLDAYRRAEVRARVAGIVTARTY 81 
170732946   5 RTQWRRMRLAPFALAALLAVAGCGKGDKDAAPETA-KQATVVTVRPTAVPMSVELPGRLDAYRQAEVRARVAGIVTARTY 83 
115351573   5 RSLARRLRLAPVALAAMLAVAGCGKGDKDKAPEAI-QNATVVTVRPTAVPMTVELPGRLDAYRQAQVRARVAGIVTARTY 83 
172060594   5 RSLARRLQLAPVAFAAMLAVAGCGKGDNDKAPEAI-QNATVVTVRPTAVPMTVELPGRLDAYRQAPVRARVAGIVTARTY 83 
30249102   81 KEGQDVRKGTPLFLINPELLKVARDEASGTLAKAEANYHDVADKLKRYKDLVSDHSISERDYQSAVAGEKQAKAELLSAR 160
116054397  82 EEGQDVRAGTVLFQIDPAPLKAALDISRGALARAEASHAAAADKLKRYADLIKDRAISEREYTEAQTDARQALAQIASAK 161
15597215   82 EEGQDVRAGTVLFQIDPAPLKAALDISRGALARAEASHAAAADKLKRYADLIKDRAISEREYTEAQTDARQALAQIASAK 161
152986788  82 EEGQDVRAGTVLFQIDPAPLKAALDISRGALARAEASHAAAADKLKRYADLVKDRAISEREYTEAQTDARQSLAQIASAR 161
218892023  82 EEGQDVRAGTVLFQIDPAPLKAALDISRGALARAEASHAAAADKLKRYADLIKDRAISEREYTEAQTDARQALAQIASAK 161
161524789  82 DEGQEVKQGAVLFRIDPAPLKAARDAAQGALAKAQAAAAAAADKRRRYADLVRDHAVSERDYTEAVAADTQAKAEVASAK 161
189350457  82 DEGQEVKQGAVLFRIDPAPLKAARDAAQGALAKAQAAAAAAADKRRRYADLVRDHAVSERDYTEAVAADTQAKAEVASAK 161
170732946  84 EEGQEVKQGAVLFRIDPAPLKAARDAAQGALAKAQAAALAATDKRRRYDDLVRDRAVSERDHTEAVAADTQAKAEVASAK 163
115351573  84 EEGQEVKQGAVLFRIDPAPLKAARDAAQGALAKAQAAALAASDKRRRYDDLVRDHAVSERDHTEAVADDTRAKADVASAK 163
172060594  84 EEGQEVKQGAVLFRIDPAPLKAARDAAQGALAKAQAAALAASDKRRRYDDLVRDRAVSERDHTEALADDTRAKADVASAK 163
30249102  161 ARLEKARLDLGYATVVSPIDGRARRALVTEGALVGQDAPTPLTTIEQIDPIYVNFSQPATEVMAMQRAIKSGKIRGIEQK 240
116054397 162 AELEQARLRLGYATVTAPIDGRARRALVTEGALVGEDSPTPLTRVEQIDPIYVNFSQPAGEVAAMQRAIREGQVKGVADK 241
15597215  162 AELEQARLRLGYATVTAPIDGRARRALVTEGALVGEDSPTPLTRVEQIDPIYVNFSQPAGEVAAMQRAIREGQVKGVADK 241
152986788 162 AELEQARLRLGYATVTAPIDGRARRALVTEGALVGEDSPTPLTRVEQIDPIYVNFSQPAGEVAAMQRAIREGQVQGVADK 241
218892023 162 AELEQARLRLGYATVTAPIDGRARRALVTEGALVGEDSPTPLTRVEQIDPIYVNFSQPAGEVAAMQRAIREGQVKGVADK 241
161524789 162 AELARAQLQLDYANVTAPISGRARRALVTEGALVGQGEATPLTTVEQLDPIYVNFSQPAADVEALRRAVKSGRATGIAQQ 241
189350457 162 AELARAQLQLDYANVTAPISGRARRALVTEGALVGQGEATPLTTVEQLDPIYVNFSQPAADVEALRRAVKSGRATGIAQQ 241
170732946 164 AELARAQLQLDYATVTAPIAGRARRALVTEGALVGQDQATPLTTVEQLDPIYVNFSQPAADVDALRRAVKSGRATGIAQH 243
115351573 164 AELARAQLQLDYATVTAPISGRARRALVTEGALVGQDQATPLTTVEQLDPIYVNFSQPAADVDALRRAVKSGHATGIAQH 243
172060594 164 AELARAQLQLDYATVTAPIAGRARRALVTEGALVGQDQATPLTTVEQLDPIYVNFSQPAADVDALRRAVKSGHATGIAQH 243
30249102  241 DIQVHLIFSDGSEYGHTGKLFFSDLAVDTSTDTVAMRALFDNPEYELLPGAYVQVRLEQAIINHAVPVPRDALVRAAGVS 320
116054397 242 DIAVRLVLADGSEYPLAGELLFSDLAVDPGTDTIAMRALFRNPHRELLPGGYVQVRLQRAVNPQAITVPRDALIRTAQSA 321
15597215  242 DIAVRLVLADGSEYPLAGELLFSDLAVDPGTDTIAMRALFRNPHRELLPGGYVQVRLQRAVNPQAITVPRDALIRTAQSA 321
152986788 242 DIAVRLVLADGSEYPLAGELLFSDLAVDPGTDTIAMRALFRNPHRELLPGGYVQVRLQRAVNPQAITVPRDALIRTAQSA 321
218892023 242 DIAVRLVLADGSEYPLAGELLFSDLAVDPGTDTIAMRALFRNPHRELLPGGYVQVRLQRAVNPQAITVPRDALIRTAQSA 321
161524789 242 DVAVTLLRADGTPYPLKGKLLFSDLAVDPTTDTVAMRALFPNPERELLPGAYVRIALDAAVDHRALLVPRDALLRTAERT 321
189350457 242 DVAVTLLRADGTPYPLKGKLLFSDLAVDPTTDTVAMRALFPNPERELLPGAYVRIALDAAVDHRALLVPRDALLRTAERT 321
170732946 244 DVAVTLLRADGTAYPLKGKLLFSDLAVDPTTDTVAMRALFPNPERELLPGAYVRIALDTAVDQRAILVPRDALLRTADRT 323
115351573 244 DVTVTLRRADGTAYPLKGKLLFSDLAVDPTTDTVAMRALFPNPERELLPGAYVRIALDAAVDQRAILVPRDALLRTAERT 323
172060594 244 DVTVTLRRADGTAYPLKGKLLFSDLAVDPTTDTVAMRALFPNPERELLPGAYVRIALDAAVDQRAILVPRDALLRTAERT 323
30249102  321 SVMIVDTEDTVQRVEVEANTLEGNHWVVTSGLQGGEKVIISNPAMMISGARVRPVVTDDQTDHSQQ 386
116054397 322 VVKVVNPQGVVEDVEVRADTLQGRDWIISRGLKGGERVIVENAAQHAAGSSVQAVVRQPASADAPS 387
15597215  322 VVKVVNPKGLVEDVEVRADTLQGRDWIISRGLKGGEWVIVENAAQHAAGSSVQAVVRQPASADAPS 387
152986788 322 VVKVVNPQGVVEDVEVHADTLQGRDWIVSRGLKGGERVIVENAAQHAAGSSVQAVVRQPASAGAPS 387
218892023 322 VVKVVNPQGVVEDVEVRADTLQGRDWIISRGLKGGERVIVENAAQHAAGSSVQAVVRQPASADAPS 387
161524789 322 SVRVVDAAGSVKDVEVVADRMSGRDWRITRGLNGGERVIVDNAAQFAPGTVVKPVD-ARPAQAAPD 386
189350457 322 SVRVVDAAGSVKDVEVVADRMSGRDWRITRGLNGGERVIVDNAAQFAPGTVVKPVD-ARPAQAAPD 386
170732946 324 SVRVVGANGKVKDVEVTADQMSGRDWRITRGLAGGERVIVDDAAQFAPDTAVKPVEKAPPSKAAPV 389
115351573 324 SVRVVGTNGKVKDVEVVADQMSGRDWRITRGLSGGERVIVDNAAQFAPDTAVKPVEQASPTKAAQP 389
172060594 324 SVRVVGTNGKVKDVEVVADQMSGRDWRITRGLSGGERVIVDNAAQFAPDTAVKPVEQASPTKAASA 389
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap