Conserved Protein Domain Family
PRK09577

?
PRK09577: PRK09577 
multidrug efflux RND transporter permease subunit
Statistics
?
PSSM-Id: 169981
View PSSM: PRK09577
Aligned: 24 rows
Threshold Bit Score: 1929.62
Threshold Setting Gi: 254000418
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30249101     1 MARFFIDRPVFAWVISLLIILAGLLSIRGLPVAQYPDIAPPVINVSATYPGASARIVEESVTAIIEREMNGAPRLMYTSA 80  
116049969    1 MARFFIDRPVFAWVISLLIVLAGVLAIRFLPVAQYPDIAPPVVNVSASYPGASAKVVEEAVTAIIEREMNGAPGLLYTKA 80  
15597214     1 MARFFIDRPVFAWVISLLIVLAGVLAIRFLPVAQYPDIAPPVVNVSASYPGASAKVVEEAVTAIIEREMNGAPGLLYTKA 80  
152987095    1 MARFFIDRPVFAWVVSLLIVLAGILAIRFLPVAQYPDIAPPVVNVSASYPGASAKVVEEALTAIIEREMNGAPGLLYTKA 80  
218892024    1 MARFFIDRPVFAWVISLLIVLAGVLAIRFLPVAQYPDIAPPVVNVSASYPGASAKVVEEAVTAIIEREMNGAPGLLYTKA 80  
76811441     1 MARFFIDRPVFAWVISLFIMLGGIFAIRALPVAQYPDIAPPVVSLYATYPGASAQVVEESVTAVIEREMNGVPGLLYTSA 80  
126438721    1 MARFFIDRPVFAWVISLFIMLGGIFAIRALPVAQYPDIAPPVVSLYATYPGASAQVVEESVTAVIEREMNGVPGLLYTSA 80  
126454286    1 MARFFIDRPVFAWVISLFIMLGGIFAIRALPVAQYPDIAPPVVSLYATYPGASAQVVEESVTAVIEREMNGVPGLLYTSA 80  
237812182    1 MARFFIDRPVFAWVISLFIMLGGIFAIRALPVAQYPDIAPPVVSLYATYPGASAQVVEESVTAVIEREMNGVPGLLYTSA 80  
83720423     1 MARFFIDRPVFAWVISLFIMLGGIFAIRALPVAQYPDIAPPVVSLYATYPGASAQVVEESVTAVIEREMNGVPGLLYTSA 80  
30249101    81 TSSPGSANINLTFRQGTDPDLAAVEVQNRLKMVEARLPEVVRRNGIFIEKSADNIQLVVSITSNDNRLTEIELGELASAN 160 
116049969   81 TSSTGQASLTLTFRQGVNADLAAVEVQNRLKIVESRLPESVRRDGIYVEKAADSIQLIVTLTSSSGRYDAMELGEIASSN 160 
15597214    81 TSSTGQASLTLTFRQGVNADLAAVEVQNRLKIVESRLPESVRRDGIYVEKAADSIQLIVTLTSSSGRYDAMELGEIASSN 160 
152987095   81 TSSTGQASLTLTFRQGVNADLAAVEVQNRLKIVESRLPESVRRDGIYVEKAADSIQLIVTLTSASGRYGAMELGEIASSN 160 
218892024   81 TSSTGQASLTLTFRQGVNADLAAVEVQNRLKIVESRLPESVRRDGIYVEKAADSIQLIVTLTSSSGRYDAMELGEIASSN 160 
76811441    81 TSSAGQASLSLTFKQGVSADLAAVDVQNRLKIVEARLPEPVRRDGISIEKAADNAQIIVSLTSEDGRLSGVELGEYASAN 160 
126438721   81 TSSAGQASLSLTFKQGVSADLAAVDVQNRLKIVEARLPEPVRRDGISIEKAADNAQIIVSLTSEDGRLSGVELGEYASAN 160 
126454286   81 TSSAGQASLSLTFKQGVSADLAAVDVQNRLKIVEARLPEPVRRDGISIEKAADNAQIIVSLTSEDGRLSGVELGEYASAN 160 
237812182   81 TSSAGQASLSLTFKQGVSADLAAVDVQNRLKIVEARLPEPVRRDGISIEKAADNAQIIVSLTSEDGRLSGVELGEYASAN 160 
83720423    81 TSSAGQASLSLTFKQGVSADLAAVDVQNRLKTVEARLPEPVRRDGISIEKAADNAQIIVSLTSEDGRLSGVELGEYASAN 160 
30249101   161 ILQALRRVEGVGKVQSFSPEYAMRIWPDPAKMTSLDLTASDLASAIRSHNARVVIGYIGDKAVPEHAPISANVAADKALA 240 
116049969  161 VLQALRRVEGVGKVQTWGAEYAMRIWPDPAKLTSMNLSASDLVNAVRRHNARLTVGDIGNLGVPDSAPISATVKVDDTLV 240 
15597214   161 VLQALRRVEGVGKVETWGAEYAMRIWPDPAKLTSMNLSASDLVNAVRRHNARLTVGDIGNLGVPDSAPISATVKVDDTLV 240 
152987095  161 VLQALRRVEGVGKVETWGAEYAMRIWPDPARLTSMNLSASDLVNAVRRHNARLTVGDIGNLGVPDSAPISATVKVDDTLV 240 
218892024  161 VLQALRRVEGVGKVETWGAEYAMRIWPDPAKLTSMNLSASDLVNAVRRHNARLTVGDIGNLGVPDSAPISATVKVDDTLV 240 
76811441   161 VLQALRRVEGVGKVQFWGAEYAMRIWPDPVKMAALGLTASDIASAVRAHNARVTIGDVGRSAVPDSAPIAATVLADAPLT 240 
126438721  161 VLQALRRVEGVGKVQFWGAEYAMRIWPDPVKMAALGLTASDIASAVRAHNARVTIGDVGRSAVPDSAPIAATVLADAPLT 240 
126454286  161 VLQALRRVEGVGKVQFWGAEYAMRIWPDPVKMAALGLTASDIASAVRAHNARVTIGDVGRSAVPDSAPIAATVLADAPLT 240 
237812182  161 VLQALRRVEGVGKVQFWGAEYAMRIWPDPVKMAALGLTASDIASAVRAHNARVTIGDVGRSAVPDSAPIAATVLADAPLT 240 
83720423   161 VLQALRRVEGVGKVQFWGAEYAMRIWPDPVKMAALGLTASDIASAVRAHNARVTIGDVGRSAVPDSAPIAATVLADAPLT 240 
30249101   241 TPEDFKNITLRTKADGGAILLRDVARVEYGGSDYSFFSRVNGKNAAGMAVKMAPGSNAVATVERIRNTMDELSRYFPPGV 320 
116049969  241 TPEQFGEIPLRIRADGGAIRLRDVARVEFGQSEYGFVSRVNQMTATGLAVKMAPGSNAVATAKRIRATLDELSRYFPEGV 320 
15597214   241 TPEQFGEIPLRIRADGGAIRLRDVARVEFGQSEYGFVSRVNQMTATGLAVKMAPGSNAVATAKRIRATLDELSRYFPEGV 320 
152987095  241 TPEQFGEIPLRIRADGGAIRLRDVARVEFGQSEYGFVSRVNQMTATGLAVKMAPGSNAVATAKRIRATLDELSRYFPEGV 320 
218892024  241 TPEQFGEIPLRIRADGGAIRLRDVARVEFGQSEYGFVSRVNRMTATGLAVKMAPGSNAVATAKRIRATLDELSRYFPEGV 320 
76811441   241 TPDAFGAIALRARADGSTLYLRDVARIEFGGNDYNYPSFVNGKTATGMGIKLAPGSNAVATEKRVRATMEELAKFFPPGV 320 
126438721  241 TPDAFGAIALRARADGSTLYLRDVARIEFGGNDYNYPSFVNGKTATGMGIKLAPGSNAVATEKRVRATMEELAKFFPPGV 320 
126454286  241 TPDAFGAIALRARADGSTLYLRDVARIEFGGNDYNYPSFVNGKTATGMGIKLAPGSNAVATEKRVRATMEELAKFFPPGV 320 
237812182  241 TPDAFGAIALRARADGSTLYLRDVARIEFGGNDYNYPSFVNGKTATGMGIKLAPGSNAVATEKRVRATMEELAKFFPPGV 320 
83720423   241 TPDAFGAIALRARADGSTLYLRDVARIEFGGNDYNYPSFVNGKTATGMGIKLAPGSNAVATEKRVRATMDELAKFFPPGV 320 
30249101   321 SYQIPYDTSAFVEVSIQKVVNTLVEAVVLVFLVMLLFMQSIRVTLIPTLVVPIALLGTFAVMYGLGFSINVLTMFGMVLA 400 
116049969  321 SYNIPYDTSAFVEISIRKVVSTLLEAMLLVFAVMYLFMQNFRATLIPTLVVPVALLGTFTVMLGLGFSINVLTMFGMVLA 400 
15597214   321 SYNIPYDTSAFVEISIRKVVSTLLEAMLLVFAVMYLFMQNFRATLIPTLVVPVALLGTFTVMLGLGFSINVLTMFGMVLA 400 
152987095  321 SYNIPYDTSAFVEISIRKVVSTLLEAMLLVFAVMYLFMQNFRATLIPTLVVPVALLGTFTVMLGLGFSINVLTMFGMVLA 400 
218892024  321 SYNIPYDTSAFVEISIRKVVSTLLEAMLLVFAVMYLFMQNFRATLIPTLVVPVALLGTFTVMLGLGFSINVLTMFGMVLA 400 
76811441   321 KYQIPYETASFVRVSMSKVVTTLVEAGVLVFAVMFLFMQNFRATLIPTLVVPVALLGTFGAMLAAGFSINVLTMFGMVLA 400 
126438721  321 KYQIPYETASFVRVSMSKVVTTLVEAGVLVFAVMFLFMQNFRATLIPTLVVPVALLGTFGAMLAAGFSINVLTMFGMVLA 400 
126454286  321 KYQIPYETASFVRVSMSKVVTTLVEAGVLVFAVMFLFMQNFRATLIPTLVVPVALLGTFGAMLAAGFSINVLTMFGMVLA 400 
237812182  321 KYQIPYETASFVRVSMSKVVTTLVEAGVLVFAVMFLFMQNFRATLIPTLVVPVALLGTFGAMLAAGFSINVLTMFGMVLA 400 
83720423   321 KYQIPYETASFVRVSMSKVVTTLVEAGVLVFAVMFLFMQNFRATLIPTLVVPVALLGTFGAMLAAGFSINVLTMFGMVLA 400 
30249101   401 IGIVVDDAIVVVENAERIIVEEGLSPYEATVKAMQQISGAIIGITVVLTSVFLPMAFFSGAVGNIYRQFSLSLATSIAFS 480 
116049969  401 IGILVDDAIIVVENVERLMAQEGLSPHDTTVKAMRQISGAIVGITVVLVSVFVPMAFFSGAVGNIYRQFAVTLAVSIGFS 480 
15597214   401 IGILVDDAIIVVENVERLMAEEGLSPHDATVKAMRQISGAIVGITVVLVSVFVPMAFFSGAVGNIYRQFAVTLAVSIGFS 480 
152987095  401 IGILVDDAIIVVENVERLMAEEGLSPHDATVKAMRQISGAIVGITVVLVSVFVPMAFFSGAVGNIYRQFAVTLAVSIGFS 480 
218892024  401 IGILVDDAIIVVENVERLMAEEGLSPHDATVKAMRQISGAIVGITVVLVSVFVPMAFFSGAVGNIYRQFAVTLAVSIGFS 480 
76811441   401 IGILVDDAIVVVENVERLMVEEKLPPYEATVKAMKQISGAIVGITVVLTSVFVPMAFFGGAVGNIYRQFAFALAVSIGFS 480 
126438721  401 IGILVDDAIVVVENVERLMVEEKLPPYEATVKAMKQISGAIVGITVVLTSVFVPMAFFGGAVGNIYRQFAFALAVSIGFS 480 
126454286  401 IGILVDDAIVVVENVERLMVEEKLPPYEATVKAMKQISGAIVGITVVLTSVFVPMAFFGGAVGNIYRQFAFALAVSIGFS 480 
237812182  401 IGILVDDAIVVVENVERLMVEEKLPPYEATVKAMKQISGAIVGITVVLTSVFVPMAFFGGAVGNIYRQFAFALAVSIGFS 480 
83720423   401 IGILVDDAIVVVENVERLMVEEKLPPYEATVKAMKQISGAIVGITVVLTSVFVPMAFFGGAVGNIYRQFAFALAVSIGFS 480 
30249101   481 AFLALSLTPALCATLLKPVDkEHHENKRGFFGWFNRTFISLTNRYQHRVGQILKRPVRWLVVYGIIIAAVALLFARLPTA 560 
116049969  481 AFLALSLTPALCATLLRPID-ADHHEKRGFFGWFNRAFLRLTGRYRNAVAGILARPVRWMLVYALVIGVVALLFVRLPQA 559 
15597214   481 AFLALSLTPALCATLLRPID-ADHHEKRGFFGWFNRAFLRLTGRYRNAVAGILARPIRWMLVYTLVIGVVALLFVRLPQA 559 
152987095  481 AFLALSLTPALCATLLRPLD-AGHHEKRGFFGWFNRTFLRLTGRYQKAVGGILARPIRWMLVYALVIGVVALLFARLPQA 559 
218892024  481 AFLALSLTPALCATLLRPID-ADHHEKRGFFGWFNRAFLRLTGRYRNAVAGILARPIRWMLVYALVIGVVALLFVRLPQA 559 
76811441   481 AFLALSLTPALCATLLKPVA-DDHHEKDGFFGWFNRFVARSTHRYTRRVGRVLERPLRWLVVYGALTAAAALLITKLPAA 559 
126438721  481 AFLALSLTPALCATLLKPVA-DDHHEKDGFFGWFNRFVARSTHRYTRRVGRVLERPLRWLVVYGALTAAAALLITKLPAA 559 
126454286  481 AFLALSLTPALCATLLKPVA-DDHHEKDGFFGWFNRFVARSTHRYTRRVGRVLERPLRWLVVYGALTAAAALLITKLPAA 559 
237812182  481 AFLALSLTPALCATLLKPVA-DDHHEKDGFFGWFNRFVARSTHRYTRRVGRVLERPLRWLVVYGALTAAAALLITKLPAA 559 
83720423   481 AFLALSLTPALCATLLKPVA-DDHHEKDGFFGWFNRFVARSTHRYTQRVGRVLKRPLRWLVVYGALTAAAALLITKLPAA 559 
30249101   561 FLPEEDQGDFMIMVMLPQGATMHETMNTLGEVSQYLQENEPVKYVYEVGGFSFYGTGASSGMIFATLQDWEERKHADQHV 640 
116049969  560 FLPEEDQGDFMIMVMQPEGTPMAETMANVADVERYLAEHEPVAYAYAVGGFSLYGDGTSSAMIFATLKDWSERREASQHV 639 
15597214   560 FLPEEDQGDFMIMVMQPEGTPMAETMANVGDVERYLAEHEPVAYAYAVGGFSLYGDGTSSAMIFATLKDWSERREASQHV 639 
152987095  560 FLPEEDQGDFMIMVMQPEGTPMAETMANVADVERYLAEHEPVAYAYAVGGFSLYGDGTSSAMIFATLKDWSERQDASQHV 639 
218892024  560 FLPEEDQGDFMIMVMQPEGTPMAETMANVGDVERYLAEHEPVAYAYAVGGFSLYGDGTSSAMIFATLKDWSERREASQHV 639 
76811441   560 FLPDEDQGNFMVMVIRPQGTPLAETMQSVRRVEEYVRTHSPSAYTFALGGYNLYGEGPNGGMIFVTMKDWKERKRARDQV 639 
126438721  560 FLPDEDQGNFMVMVIRPQGTPLAETMQSVRRVEEYVRTHSPSAYTFALGGYNLYGEGPNGGMIFVTMKDWKERKRARDQV 639 
126454286  560 FLPDEDQGNFMVMVIRPQGTPLAETMQSVRRVEEYVRTHSPSAYTFALGGYNLYGEGPNGGMIFVTMKDWKERKRARDQV 639 
237812182  560 FLPDEDQGNFMVMVIRPQGTPLAETMQSVRRVEEYVRTHSPSAYTFALGGYNLYGEGPNGGMIFVTMKDWKERKRARDQV 639 
83720423   560 FLPDEDQGNFMVMVIRPQGTPLAETMQSVRRVEEYVRTHSPSAYTFALGGYNLYGEGPNGGMIFVTMKDWKERKRAQDQV 639 
30249101   641 RSIVERVNMHFYGRPNLTVFALNTPPLPELGSSSGFDLRLQDRGNVGYKTLAAARDRLLAEGGQHPVLTNLMFAGLAEAP 720 
116049969  640 GAIVERINQRFAGLPNRTVYAMNSPPLPDLGSTSGFDFRLQDRGGVGYEALVKARDQLLARAAEDPRLANVMFAGQGEAP 719 
15597214   640 GAIVERINQRFAGLPNRTVYAMNSPPLPDLGSTSGFDFRLQDRGGVGYEALVKARDQLLARAAEDPRLANVMFAGQGEAP 719 
152987095  640 GAIVERINQRFAGLPNRTVYAMNSPPLPDLGSTSGFDFRLQDRGGVGYDALVKARDQLLARAAEDPRLANVMFAGQGEAP 719 
218892024  640 GAIVERINQRFAGLPNRTVYAMNSPPLPDLGSTSGFDFRLQDRGGVGYEALVKARDQLLARAAEDPRLANVMFAGQGEAP 719 
76811441   640 QAIIAEINAHFAGTPNTMVFAINMPALPDLGLTGGFDFRLQDRGGLGYGAFVAAREKLLAEGRKDPVLTDLMFAGTQDAP 719 
126438721  640 QAIIAEINAHFAGTPNTMVFAINMPALPDLGLTGGFDFRLQDRGGLGYGAFVAAREKLLAEGRKDPVLTDLMFAGTQDAP 719 
126454286  640 QAIIAEINAHFAGTPNTMVFAINMPALPDLGLTGGFDFRLQDRGGLGYGAFVAAREKLLAEGRKDPVLTDLMFAGTQDAP 719 
237812182  640 QAIIAEINAHFAGTPNTMVFAINMPALPDLGLTGGFDFRLQDRGGLGYGAFVAAREKLLAEGRKDPVLTDLMFAGTQDAP 719 
83720423   640 QAIIAGINAHFAGTPNTMVFAINMPALPDLGLTGGFDFRLQDRGGLGYGAFVAAREKLLADGRKDPVLTDLMFAGTQDAP 719 
30249101   721 VINLDINRRKAQALGVTMDEINATLAVMFGSDYIGDFMHGNQVRRVIVQADGKNRIELDDIRKLRVRNAAGKLVPLSSFV 800 
116049969  720 QIRLDIDRRKAETLGVSMDEINTTLAVMFGSDYIGDFMHGSQVRKVVVQADGAKRLGIDDIGRLHVRNEQGEMVPLATFA 799 
15597214   720 QIRLDIDRRKAETLGVSMDEINTTLAVMFGSDYIGDFMHGSQVRKVVVQADGAKRLGIDDIGRLHVRNEQGEMVPLATFA 799 
152987095  720 QIRLDIDRRKAETLGVSMDEINTTLAVMFGSDYIGDFMHGSQVRKVVVQADGARRLSIDDIGKLHVRNEQGEMVPLATFA 799 
218892024  720 QIRLDIDRRKAETLGVSMDEINTTLAVMFGSDYIGDFMHGSQVRKVVVQADGAKRLGIDDIGRLHVRNEQGEMVPLATFA 799 
76811441   720 QLKLDIDRAKASALGVSMEEINATLAVMFGSDYIGDFMHGSQVRRVIVQADGRHRLDAADVTKLRVRNAKGEMVPLAAFA 799 
126438721  720 QLKLDIDRAKASALGVSMEEINATLAVMFGSDYIGDFMHGSQVRRVIVQADGRHRLDAADVTKLRVRNAKGEMVPLAAFA 799 
126454286  720 QLKLDIDRAKASALGVSMEEINATLAVMFGSDYIGDFMHGSQVRRVIVQADGRHRLDAADVTKLRVRNAKGEMVPLAAFA 799 
237812182  720 QLKLDIDRAKASALGVSMEEINATLAVMFGSDYIGDFMHGSQVRRVIVQADGRHRLDAADVTKLRVRNAKGEMVPLAAFA 799 
83720423   720 QLKLDIDRAKASALGVSMEEINATLAVMFGSDYIGDFMHGSQVRRVIVQADGQHRLDPGDVTKLRVRNAKGEMVPLAAFA 799 
30249101   801 SLEWGMGLPQLTRYNGFPSFTINGNAAAGKSSGEAMREIEHIVAKLPNGIGFDWSGQSLEERLSGDQAPFLFGLSVLIVF 880 
116049969  800 KAAWTLGPPQLTRYNGYPSFNLEGQAAPGYSSGEAMQAMEELMQGLPEGIAHEWSGQSFEERLSGAQAPALFALSVLIVF 879 
15597214   800 KAAWTLGPPQLTRYNGYPSFNLEGQAAPGYSSGEAMQAMEQLMQGLPEGIAHEWSGQSFEERLSGAQAPALFALSVLIVF 879 
152987095  800 RAAWTLGPPQLTRYNGYPSFNLEGQAAPGYSSGEAMAAMEQLMQGLPEGVAHEWSGQSYEERLSGAQAPALFALSVLIVF 879 
218892024  800 KAAWTLGPPQLTRYNGYPSFNLEGQAAPGYSSGEAMQAMEQLMQGLPEGIAHEWSGQSFEERLSGAQAPALFALSVLIVF 879 
76811441   800 TLHWTMGPPQLTRYNGFPSFTINGAASAGHSSGEAMAAIERIASTLPAGTGYAWSGQSYEERLSGAQAPMLFALSVLVVF 879 
126438721  800 TLHWTMGPPQLTRYNGFPSFTINGAASAGHSSGEAMAAIERIASTLPAGTGYAWSGQSYEERLSGAQAPMLFALSVLVVF 879 
126454286  800 TLHWTMGPPQLTRYNGFPSFTINGAASAGHSSGEAMAAIERIASTLPAGTGYAWSGQSYEERLSGAQAPMLFALSVLVVF 879 
237812182  800 TLHWTMGPPQLTRYNGFPSFTINGAASAGHSSGEAMAAIERIASTLPAGTGYAWSGQSYEERLSGAQAPMLFALSVLVVF 879 
83720423   800 TLHWTMGPPQLTRYNGFPSFTINGAASAGHSSGEAMAAIERIASALPAGIGYAWSGQSYEERLSGAQAPMLFALSVLVVF 879 
30249101   881 LALAALYESWLIPQAVILVVPLGVLGAVLGVTLRDMPNDIYFKVGLIAMIGLSAKNAILIVEVAKELYDSGMSLIDATLE 960 
116049969  880 LALAALYESWSIPLAVILVVPLGVLGALHGVSLRGLPNDIYFKVGLITIIGLSAKNAILIIEVAKDHYQEGMSLLQATLE 959 
15597214   880 LALAALYESWSIPLAVILVVPLGVLGALLGVSLRGLPNDIYFKVGLITIIGLSAKNAILIIEVAKDHYQEGMSLLQATLE 959 
152987095  880 LALAALYESWSIPLAVILVVPLGVLGALLGVSLRGLPNDIYFKVGLITIIGLSAKNAILIIEVAKDHYQEGMDLLQATLE 959 
218892024  880 LALAALYESWSIPLAVILVVPLGVLGALLGVSLRGLPNDIYFKVGLITIIGLSAKNAILIIEVAKDHYQEGMSLLQATLE 959 
76811441   880 LALAALYESWSIPFAVMLVVPLGVIGAVAGVTLRGMPNDIYFKVGLIATIGLSAKNAILIVEVAKDLVAQRMSLADAALE 959 
126438721  880 LALAALYESWSIPFAVMLVVPLGVIGAVAGVTLRGMPNDIYFKVGLIATIGLSAKNAILIVEVAKDLVAQRMSLADAALE 959 
126454286  880 LALAALYESWSIPFAVMLVVPLGVIGAVAGVTLRGMPNDIYFKVGLIATIGLSAKNAILIVEVAKDLVAQRMSLADAALE 959 
237812182  880 LALAALYESWSIPFAVMLVVPLGVIGAVAGVTLRGMPNDIYFKVGLIATIGLSAKNAILIVEVAKDLVAQRMSLADAALE 959 
83720423   880 LALAALYESWSIPFAVMLVVPLGVIGAVAGVTLRGMPNDIYFKVGLIATIGLSAKNAILIVEVAKDLVAQGMSLADAALE 959 
30249101   961 AARLRLRPIIMTSLAFGAGVLPLALATGAASGAQTAIGTSVFGGNVMATALAIFLVPLFFAVIGRYIKRSRHS 1033
116049969  960 AARLRLRPIVMTSLAFGFGVVPLALSSGAGSGAQVAIGTGVLGGIVTATVLAVFLVPLFFLVVGRLFRLRKAP 1032
15597214   960 AARLRLRPIVMTSLAFGFGVVPLALSSGAGSGAQVAIGTGVLGGIVTATVLAVFLVPLFFLVVGRLFRLRKAP 1032
152987095  960 AARLRLRPIVMTSLAFGFGVIPLALSSGAGSGAQIAIGTGVLGGIVTATVLAVFLVPLFFLVVGRLFRLRKAP 1032
218892024  960 AARLRLRPIVMTSLAFGFGVIPLALSSGAGSGAQVAIGTGVLGGIVTATVLAVFLVPLFFLVVGRLFRLRKAP 1032
76811441   960 AARLRLRPIVMTSLAFGVGVLPLAFATGAASGAQIAIGTGVLGGVISATLFAIFLVPLFFVCVGRVFDVVPRR 1032
126438721  960 AARLRLRPIVMTSLAFGVGVLPLAFATGAASGAQIAIGTGVLGGVISATLFAIFLVPLFFVCVGRVFDVVPRR 1032
126454286  960 AARLRLRPIVMTSLAFGVGVLPLAFATGAASGAQIAIGTGVLGGVISATLFAIFLVPLFFVCVGRVFDVVPRR 1032
237812182  960 AARLRLRPIVMTSLAFGVGVLPLAFATGAASGAQIAIGTGVLGGVISATLFAIFLVPLFFVCVGRVFDVVPRR 1032
83720423   960 AARLRLRPIVMTSLAFGVGVLPLAFATGAASGAQIAIGTGVLGGVISATLFAIFLVPLFFVCVGRVVDIVPRR 1032
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap