Conserved Protein Domain Family
emrE

?
PRK09541: emrE 
EmrE family multidrug efflux SMR transporter
Statistics
?
PSSM-Id: 137367
View PSSM: PRK09541
Aligned: 30 rows
Threshold Bit Score: 180.934
Threshold Setting Gi: 50121906
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15830868    1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG 80 
16128526    1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG 80 
170080124   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG 80 
209400746   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGLFG 80 
209917769   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG 80 
218694205   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG 80 
238899820   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG 80 
253774471   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYGIWSGVGIVLISLLLWGFFG 80 
254793994   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGLFG 80 
254160610   1 MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYGIWSGVGIVLISLLLWGFFG 80 
15830868   81 QRLDLPAVIGMMLICAGVLVINLLSRSTPH 110
16128526   81 QRLDLPAIIGMMLICAGVLIINLLSRSTPH 110
170080124  81 QRLDLPAIIGMMLICAGVLIINLLSRSTPH 110
209400746  81 QRLDLPAIIGMMLICAGVLVINLLSRSTPH 110
209917769  81 QRLDLPAIIGMMLICAGVLVINLLSRSTPH 110
218694205  81 QRLDLPAIIGMMLICAGVLVINLLSRSTPH 110
238899820  81 QRLDLPAIIGMMLICAGVLIINLLSRSTPH 110
253774471  81 QRLDLPAIIGMMLICAGVLVINLLSRSTPH 110
254793994  81 QRLDLPAIIGMMLICAGVLVINLLSRSTPH 110
254160610  81 QRLDLPAIIGMMLICAGVLVINLLSRSTPH 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap