Conserved Protein Domain Family
PRK09517

?
PRK09517: PRK09517 
multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional
Statistics
?
PSSM-Id: 169939
View PSSM: PRK09517
Aligned: 6 rows
Threshold Bit Score: 907.812
Threshold Setting Gi: 170781514
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62390346    1 MTDFSLYLVTDPVLGGGPEKVAGIVDSAISGGVSVVQLRDKNSGVEDVRAAAKELKELCDARGVA--------LVVNDYL 72 
161486710   1 MTDFSLYLVTDPVLGGGPEKVAGIVDSAISGGVSVVQLRDKNSGVEDVRAAAKELKELCDARGVA--------LVVNDYL 72 
145295597   1 MTDFSLYLVTDPVLGGGPEKVAGIVDSAISGGVSVVQLRDKNSGVEDVRAAAKELKELCDARGVA--------LVVNDYL 72 
170781514   3 GLDLSVYLVTDPALCGA-RGVPAVVAAAVAGGATAVQIRDKHASAAELLATVVAAADAIDAHASAhptaprplLLVDDRV 81 
148273300   3 ALDLSVYLVTDPALCGA-RGVPAVVAAAVAGGAMAVQIRDKHASAAELLATVVAAAEAIDAHAAAhpsarrplLLVDDRV 81 
25028147    1 MTDFSLYLVTDPHLGGGPERVAGIVEDAINGGVTVVQLRDKDADEQTFREHAMELKRVCDRLGVP--------LFLNDRF 72 
62390346   73 DIAVELGLH------LHIGQGDTPYTQARELLPA-----HLELGLSIENLDQLHAVIAQCAETGVALPDVIGIGPVASTA 141
161486710  73 DIAVELGLH------LHIGQGDTPYTQARELLPA-----HLELGLSIENLDQLHAVIAQCAETGVALPDVIGIGPVASTA 141
145295597  73 DIAVELGLH------LHIGQGDTPYTQARELLPA-----HLELGLSIENLDQLHAVIAQCAETGVALPDVIGIGPVASTA 141
170781514  82 DVVLAALARgarvdgVHVGQSDVPADLVRRMLDAaspdrRLVVGLTANTPAHVEALRALPAGT----VDYLGVGVIRPTS 157
148273300  82 DVVLAALARgvrvdgVHVGQSDVPADLVRRMLDAaspdrRLVVGLTANTPAHVEAVRALPAGT----VDYLGVGVIRPTS 157
25028147   73 AVAAELSCH------VHIGQGDLPYVQARRQLPG-----HLMIGLTIETMDQLETVIADCTRAGIALPDVVGLGPVQATD 141
62390346  142 TKPDAAPALGVEGIAEIAAVAQDHGIASVAIGGVGLRNAAELAATPIDGLCVVSEIMTAANPAAAATRLRTAFQPTFSPE 221
161486710 142 TKPDAAPALGVEGIAEIAAVAQDHGIASVAIGGVGLRNAAELAATPIDGLCVVSEIMTAANPAAAATRLRTAFQPTFSPE 221
145295597 142 TKPDAAPALGVEGIAEIAAVAQDHGIASVAIGGVGLRNAAELAATPIDGLCVVSEIMTAANPAAAATRLRTAFQPTFSPE 221
170781514 158 TKPDHPAPLGHDGFGIIAGLSP---VPCVAIGGVDVRDVDAIAAAGGAGTAVVSAICAAEDPEAAARELAEARARARARP 234
148273300 158 TKPDHPAPLGHDGFGIIAGLSP---VPCVAIGGVDVRDVAAIAAAGGAGTAVVSAICAGEDPGAAARELAEAWARVRAAA 234
25028147  142 TKPDAPQAVGVDGVAAMAKVARAHGIASVAIGGVGLANAADLARTGVDGLCVVSAIMAAPSPAEAARELLDVWEAGRRV- 220
62390346  222 TQTELSQTELQGAFVNSP-------SAPRVLSIAGTDPTGGAGIQADLKSIAAGGGYGMCVVTSLVAQNTHGVNTIHTPP 294
161486710 222 TQTELSQTELQGAFVNSP-------SAPRVLSIAGTDPTGGAGIQADLKSIAAGGGYGMCVVTSLVAQNTHGVNTIHTPP 294
145295597 222 TQTELSQTELQGAFVNSP-------SAPRVLSIAGTDPTGGAGIQADLKSIAAGGGYGMCIVTSLVAQNTHGVNTIHTPP 294
170781514 235 ATTGDATDDPAEVVASSEdhapplrPVPRVLSIAGTDPTGGAGIQADLKSIAANGGYGMAVVTALVAQNTTGVREIHVPP 314
148273300 235 GDATAAEDDASARALR---------PVPRVLSIAGTDPTGGAGIQADLKSIAANGGYGMAVVTALVAQNTTGVREIHVPP 305
25028147  221 -------------------------AQPRVLTIAGTDPTGGAGVQADLKSIAAAGGFGMSVITALVAQNTHGVTGVHTPP 275
62390346  295 LTFLEEQLEAVFSDVTVDAIKLGMLGSADTVDLVASWLGSHEHGPVVLDPVMIATSGDRLLDASAEESLRRLAVHVDVVT 374
161486710 295 LTFLEEQLEAVFSDVTVDAIKLGMLGSADTVDLVASWLGSHEHGPVVLDPVMIATSGDRLLDASAEESLRRLAVHVDVVT 374
145295597 295 LTFLEEQLEAVFSDVTVDAIKLGMLGSADTVDLVASWLGSHEHGPVVLDPVMIATSGDRLLDASAEESLRRLAVHVDVVT 374
170781514 315 VAFLRAQLDAVSDDVAIDAVKIGMLGSAAVVDEVAAWLGAVRPPVVVLDPVMVAQSGDALLDADATEALRRLLPLADVVT 394
148273300 306 VAFLRAQLDAVSDDVAIDAVKIGMLGSAAVVDEVADWLRAVRPPVVVLDPVMVAQSGDALLDADATEALRRLLPLADVVT 385
25028147  276 ADFLDEQLESVFSDVTVDAVKLGMLGRADTVRQVTGWLRTRPHGPVILDPVMVATSGDSLLDPDATEALLELATVVDVIT 355
62390346  375 PNIPELAVLCDSAPAITMDEAIAQAQGFARTHDTIVIVKGGHLTGALADNAVVRP-----DGSVFQVENLRVNTTNSHGT 449
161486710 375 PNIPELAVLCDSAPAITMDEAIAQAQGFARTHDTIVIVKGGHLTGALADNAVVRP-----DGSVFQVENLRVNTTNSHGT 449
145295597 375 PNIPELAVLCDSAPAITMDEAIAQAQGFARTHDTIVIVKGGHLTGTLADNAVVRP-----DGSVFQVENLRVNTTNSHGT 449
170781514 395 PNLPELAALLGEREADGWEAALAQGRTLATRHGVRVVVKGGHLRVDDCPDALVTPgaggaGPTAHVVDGPRIATTSTHGT 474
148273300 386 PNLPELAALLGEREADGWDEALAQGRTLAVRHGVRVVVKGGHLRVDDCPDALVTPgaagaEAAVHVVDGPRITTTSTHGT 465
25028147  356 PNIPELAVLCGEQPAPSFDAAIEQARRFATDVGTTVIVKGGHLTGPRADNAVVYP-----DGSVHMVANPRVDTTNSHGT 430
62390346  450 GCSLSASLATKIAAGESVEKALEWSTRWLNEALRHADHLAVGTGNGPVDHGHLARRMTHAAETTPWAHLRAprldGATAA 529
161486710 450 GCSLSASLATKIAAGESVEKALEWSTRWLNEALRHADHLAVGTGNGPVDHGHLARRMTHAAETTPWAHLRAprldGATAA 529
145295597 450 GCSLSASLATRIAAGESVEKALEWSTRWLNEALRHADHLAVGTGNGPVDHGHLARRMTHAAETTPWAHLRAprldGATAA 529
170781514 475 GCSLSSALATLQPRRDDWRAALTEAKAWLTGSLAHAEDLGVGSGAGPLDH---LRALWDAAGTH---------------- 535
148273300 466 GCSLSSALATLHPRRGDWLSALTEAKAWLTGSLAHAEDLEVGSGAGPLDH---LRALWDAAGTH---------------- 526
25028147  431 GCSLSAALATRMGAGHPVDKALDWATRWLNEALRGADALQVGSGSGPVDHFAVTRRLLRAADATPWPHLRM----GAPSD 506
62390346  530 SFTTPSTVKSPAPRIEPAGPFTRALWEASGDIIAGINSSDFITMLGDGTLRRPEFDFYIDQDAQYLAQYSRALARLSSIA 609
161486710 530 SFTTPSTVKSPAPRIEPAGPFTRALWEASGDIIAGINSSDFITMLGDGTLRRPEFDFYIDQDAQYLAQYSRALARLSSIA 609
145295597 530 SFTTPSTVKSPAPRIEPAGPFTRALWEASGEIIAGINSSDFITMLGDGTLRRPEFDFYIDQDAQYLAQYSRALARLSSIA 609
170781514 536 -----------------AGPISAEMWAGSAGLRREIDDLPFVRRLGDGTLPEAWFSHYLAQDAIYLRAYSRVLARASQLA 598
148273300 527 -----------------AGPISAEMWAGSADLRREIDDLAFVRRLGDGTLPEAWFSHYLAQDAIYLRAYSRVLARASQLA 589
25028147  507 GIITPSDTQSPAPALAPAGPYTRALWEATGDVLGEILDSGFIRGLGDGTLSREEFLFYIDQDAHYLRQYSRALATLSSRA 586
62390346  610 PDSHAQIEWAQSAAECLVVEAELHRSYMAGKEV----SAPSHITMAYTDFLIARTYTEDYVCGVAAVLPCYWLYAEIGLM 685
161486710 610 PDSHAQIEWAQSAAECLVVEAELHRSYMAGKEV----SAPSHITMAYTDFLIARTYTEDYVCGVAAVLPCYWLYAEIGLM 685
145295597 610 PDSHAQIEWAQSAAECLVVEAELHRSYMTGKEV----SAPSHITMAYTDFLIARTYTEDYVCGVAAVLPCYWLYAEIGLM 685
170781514 599 PAPDAQVVWARSAADAIAAESALHEEWLSRHPAp---AVAGPVTRAYVDHLLAHAATSDYAVLVAALLPCFTIYADVGTR 675
148273300 590 PTPDAQVVWARSAADAIAAESTLHEEWLSRHPAp---AVAGPVTRAYVDHLLAHAATSDYAVLVAALLPCFTIYADVGTR 666
25028147  587 PDAPAQVDWATSAAECITVEAELHRTYLNKGLAetgvSAPSPVTMAYTDFLIARSHADDYVVGAAAVLPCYWLYAEIGLI 666
62390346  686 L------AEQNHDEHPYKDWLNTYSGEEFIAGTRAAIARLEKALENAGAEQRVDAARAFLSASVHEREFFDQATRHGWT 758
161486710 686 L------AEQNHDEHPYKDWLNTYSGEEFIAGTRAAIARLEKALENAGAEQRVDAARAFLSASVHEREFFDQATRHGWT 758
145295597 686 L------AEQNHDEHPYKDWLNTYSGEEFIAGTRAAIARLEKALENAGAEQRVDAARAFLSASVHEREFFDQATRHGWT 758
170781514 676 LraagseAAAAGVAHPYAAWLATYADPAFAEATRRASELVDEAAVLAGPTRRAAMLEASLLSSAYERDFFHAPEALG-- 752
148273300 667 LraagsaAASAGEAHPYAAWLATYADPGFAAATRRACELVDEAAVIAGPSRRTAMLEASLLSSAYERDFFRAPEALG-- 743
25028147  667 L------AKQNHPEHPYTDWLDTYSGEGFLAGTVKAIARVEAAMAGAGPDQQRVAAQTYLSACVHEREFFDQATRQGWN 739
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap