Conserved Protein Domain Family
cspE

?
PRK09507: cspE 
cold shock-like protein CspE
Statistics
?
PSSM-Id: 169931
View PSSM: PRK09507
Aligned: 97 rows
Threshold Bit Score: 127.461
Threshold Setting Gi: 123443227
Created: 9-Dec-2010
Updated: 17-Jun-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157146760  32 MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL 100
197284318   1 MSKLKGNVKWFNETKGFGFITPEDGSKDVFVHFSAIVSEGFKTLAEGQKVEFEVTDGAKGPSAANVVAI 69 
253990644  11 MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQSNGFKTLAEGQKVEFEITDGAKGPSAVNVVAI 79 
21672738    1 MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQSNGFKTLAEGQSVEFEITEGAKGPSAANVISL 69 
94676996    1 MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQSNGFKTLAEGQRVEFEITNGAKGPSAADVIAI 69 
116515229   1 MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQSNGFKTLAEGQSVEFEITEGAKGPSAANVVSV 69 
219681838   1 MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQSNGFKTLAEGQSVEFEITEGAKGPSAANVISL 69 
15617086    1 MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQSNGFKTLAEGQSVEFEITEGAKGPSAANVISL 69 
27904911    1 MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQSNGFKTLSEGQSVEFEITEGAKGPSAANVISL 69 
219682393   1 MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQSNGFKTLAEGQSVEFEITEGAKGPSAANVISL 69 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap