Conserved Protein Domain Family
sifB

?
PRK09499: sifB 
type III secretion system effector SifB
Statistics
?
PSSM-Id: 137339
View PSSM: PRK09499
Aligned: 13 rows
Threshold Bit Score: 627.409
Threshold Setting Gi: 161503304
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
194451488   1 MPITIGRGFLKSEMFSQSAISQRSFFTLLWERIKDFFCDTQRSTADQYIKELCDVASPPDAQRLFDLFCALYELSSPSCR 80 
161503304   1 MPITIGSSFLKSELFPENSNTQRSFFYLLWEAIKEFFCGTGRADADRYIKELCNITSPPGAQRLLDLFCALYKLSSPTCR 80 
161613942   1 MPITIGRGFLKSEMFSQSAISQRSFFTLLWEKIKDFFCSTRRSAADQYIKELCDVASPPDAQRLFDLFCALYELSSPSCR 80 
224583905   1 MPITIGRGFLKSEMFSQSAISQRSFFTLLWEKIKDFFCDTQRSTAEQYIKELCDVASPPDAQRLFDLFCVLYELSSPSCR 80 
197251512   1 MPITIGRGFLKSEMFSQSAISQRSFFTLLWEKIKDFFCDTQRSTADQYIKELCDVASPPDAQRLFDLFCALYELSSPSCR 80 
29141955    1 MPITIGRGFLKSEMFSQSAISQRSFFTSLWEKIKDFFCDTQRSTADQYIKELCDVASPPDAQRLFDLFCALYELSSPSCR 80 
16760278    1 MPITIGRGFLKSEMFSQSAISQRSFFTSLWEKIKDFFCDTQRSTADQYIKELCDVASPPDAQRLFDLFCALYELSSPSCR 80 
16764946    1 MPITIGRGFLKSEMFSQSAISQRSFFTLLWEKIKDFFCDTQRSTADQYIKELCDVASPPDAQRLFDLFCKLYELSSPSCR 80 
198242920   1 MPITIGRGFLKSEMFSQSAISQRSFFTLLWEKIKDFFCDTQRSTADQYIKELCDVASPPDAQRLFDLFCALYELSSPSCR 80 
194444447   1 MPITIGRGFLKSEMFSQSAISQRSFFTLLWERIKDFFCDTQRSTADQYIKELCDVASPPDAQRLFDLFCKLYELSSPSCR 80 
162139584   1 MPITIGRGFLKSEMFSQSAISQRSFFTLLWEKIKDFFCDTQRSTADQYIKELCDVASPPDAQRLFDLFCVLYELSSPSCR 80 
207856904   1 MPITIGRGFLKSEMFSQSAISQRSFFTLLWERIKDFFCDTQRSTADQYIKELCDVASPPDAQRLFDLFCALYELSSPSCR 80 
194734475   1 MPITIGRGFLKSEMFSQSAISQRSFFTLLWEKIKDFFCSTRRSAADQYIKELCDVASPPDAQRLFDLFCKLYELSSPSCK 80 
194451488  81 GNFHFQHYKDAECQYTNLFIKDGEDIPLCIVIRQDHYYYDIMNRTVLCVDTQPAHLKRYSDITIKASTYVCEELCCLFPE 160
161503304  81 DNFHFEYYKDAECQYTNLYIEDGAETPLRIVIRQDYYYYSIMDKTVTCIYTYPETLKTYPDVSIKTGTYVCEPLCCLFPE 160
161613942  81 GNFHFQHYKDAECQYTNLCIKDGEDIPLCIMIRQDHYYYEIMNRTVLCVDTQSAHLKRYSDINIKASTYVCEPLCCLFPE 160
224583905  81 GNFHFQHYKDAECQYTNLCIKDGEDIPLCIMIRQDHYYYEIMNRTVLCVDTQSAHLKRYSDINIKASTYVCEPLCCLFPE 160
197251512  81 GNFHFQHYKDAECQYTNLCIKDGEDIPLCIMIRQDHYYYEIMNRTVLCVDTQSAHLKRYSDINIKASTYVCEPLCCLFPE 160
29141955   81 GNFHFQHYKDAECQYTNLCIKDGEDIPLCIMIRQDHYYYEIMNRTVLCVDTQSAHLKRYSDINIKASTYVCEPLCCLFPE 160
16760278   81 GNFHFQHYKDAECQYTNLCIKDGEDIPLCIMIRQDHYYYEIMNRTVLCVDTQSAHLKRYSDINIKASTYVCEPLCCLFPE 160
16764946   81 GNFHFQHYKDAECQYTNLCIKDGEDIPLCIMIRQDHYYYEIMNRTVLCVDTQSAHLKRYSDINIKASTYVCEPLCCLFPE 160
198242920  81 GNFHFQHYKDAECQYTNLCIKDGEDIPLCIMIRQDHYYYEIMNRTVLCVDTQSAHLKRYSDINIKASTYVCEPLCCLFPE 160
194444447  81 GNFHFQHYKDAECQYTNLCIKDGEDIPLCIMIRQDHYYYEIMNRTVLCVDTQSAHLKRYSDINIKASTYVCEPLCCLFPE 160
162139584  81 GNFHFQHYKDAECQYTNLCIKDGEDIPLCIMIRQDHYYYEIMNRTVLCVDTQSAHLKRYSDINIKASTYVCESLCCLFPE 160
207856904  81 GNFHFQHYKDAECQYTNLFIKDGEDIPLCIVIRQDHYYYDIMNRTVLCVDTQPAHLKRYSDITIKASTYVCEELCCLFPE 160
194734475  81 EKFHFQHYKDGEYQYTNLCIKDGEDIPLCIVIRQDHYYYDIMNRTVLCVDTQSAHLKRYSDINIKTSTYVCEELCCLFPE 160
194451488 161 RLLLSLSGGITFPVDLKNIKETLIAMAEKGNLCDWKEQERKAAISSRINLGIAQADVPPIDDAIKNKIAAKVIENTNLTN 240
161503304 161 RLLLTLPGDITFSISLNEIKETLIGMAENGTLYSWKEQERKIAISSRINTGIARAGVTHIDKATQNIIASKAISAADLKN 240
161613942 161 RLQLSLSGGITFSVDLKNIEETLIAMAEKGNLCDWKEQERKAAISSRINLGIAQAGVTAIDDAIKNKIAAKVIENTNLKN 240
224583905 161 RLQLSLSGGITFPVDLKNIEETLIAMAEKGNLCDWKEQERKAAISSRINLGIAQAGVTAIDDAIKNKIAAKVIENTNLKN 240
197251512 161 RLLLSLSGGITFPVDLKNIEETLIAMAEKGNLCDWKEQERKAAISSRINLGIAQAGVTAIDDAIKNKIAAKVIENTNLTN 240
29141955  161 RLQLSLSGGITFSVDLKNIEETLIAMAEKGNLCDWKEQERKAAISSRINLGIAQAGVTAIDDAIKNKIAAKVIENTNLKN 240
16760278  161 RLQLSLSGGITFSVDLKNIEETLIAMAEKGNLCDWKEQERKAAISSRINLGIAQAGVTAIDDAIKNKIAAKVIENTNLKN 240
16764946  161 RLQLSLSGGITFSVDLKNIEETLIAMAEKGNLCDWKEQERKAAISSRINLGIAQAGVTAIDDAIKNKIAAKVIENTNLKN 240
198242920 161 RLQLSLSGGITFSVDLKNIEETLIAMAEKGNLCDWKEQERKAAISSRINLGIAQAGVTAIDDAIKNKIAAKVIENTNLKN 240
194444447 161 RLQLSLSGGITFSVDLKNIEETLIAMAEKGNLCDWKEQERKAAISSRINLGIAQAGVTAIDDAIKNKIAAKVIENTNLKN 240
162139584 161 RLQLSLSGGITFPVDLKNIEETLIAMAEKGNLCDWKEQERKAAISSRINLGIAQAGVTAIDDAIKNKIAAKVIENTNLKN 240
207856904 161 RLLLSLSGGITFPVDLKNIKETLIAMAEKGNLCDWKEQERKAAISSRINLGIAQADVPPIDDAIKNKIAAKVIENTNLKN 240
194734475 161 RLLLSLSGGITFSVDLKNIKETLIAMAEKGNLCDWKEQERKAAISSRISLGITQADLPPIDDAIKNKIAAKVIEDTNLKN 240
194451488 241 ATFEPNYVQSSVTQIVYSCLFKNEILMNMLEESSSHGLLCLNDLAEYVALQVHNSLFSEDLSSLVETTKNEAHYQS 316
161503304 241 TIYDANYTQSSIMQMVYSCLFKNDILANLLYEETCYNQLCLNELTEYVALQIHNCLFSENLSSLVEIAEKETHHQL 316
161613942 241 AAFEPNYAQSSVTQIVYSCLFKNEILMNMLEESSSHGLLCLNELTEYVALQVHNSLFSEDLSSLVETTKNEAHYQS 316
224583905 241 AAFEPNYAQSSVTQIVYSCLFKNEILMNMLEESSSHGLLCLNELTEYVALQVHNSLFSEDLSSLVETTKNEAHYQS 316
197251512 241 AIFEPNHTQSSVTQLVYSCLFKNEILMNMLEENSSHDLLCLNDLAEYVALQVHNSLFSEDLSSLVETTKNEAHHQS 316
29141955  241 AAFEPNYAQSSVTQIIYSCLFKNEILMNMLEESSSHGLLCLNELTEYVALQIHNSLFSEDLSSLVETTKNEAHYQS 316
16760278  241 AAFEPNYAQSSVTQIIYSCLFKNEILMNMLEESSSHGLLCLNELTEYVALQIHNSLFSEDLSSLVETTKNEAHYQS 316
16764946  241 AAFEPNYAQSSVTQIVYSCLFKNEILMNMLEESSSHGLLCLNELTEYVALQVHNSLFSEDLSSLVETTKNEAHHQS 316
198242920 241 AAFEPNYAQSSVTQIVYSCLFKNEILMNMLEESSSHGLLCLNELTEYVALQVHNSLFSEDLSSLVETTKNEAHHQS 316
194444447 241 AAFEPNYAQSSVTQIVYSCLFKNEILMNMLEESSSHGLLCLNDLAEYVALQVHNSLFSEDLSSLVETTKNEAHHQS 316
162139584 241 AAFEPNYAQSSVTQIVYSCLFKNEILMNMLEESSSHGLLCLNELTEYVALQVHNSLFSEDLSSLVETTKNEAHYQS 316
207856904 241 AAFEPNYAQSSVTQIVYSCLFKNEILMNMLEESSFHGLLCLNELTEYVALQVHNSLFSEDLSSLVETTKNEAHHQS 316
194734475 241 ATFEPNYAQSSVTQLVYSCLFKNEILMNMLEESSSHGLLCLNDLVEYVALQVHNSLFSEDLSSLVETTKNEAHHQS 316
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap