Conserved Protein Domain Family
aroDE

?
PRK09310: aroDE 
bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase
Statistics
?
PSSM-Id: 137204
View PSSM: PRK09310
Aligned: 14 rows
Threshold Bit Score: 792.075
Threshold Setting Gi: 16751990
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62185307    1 MLCATISGPTFAEAKQQLLHSLPLVDSIELRIDCLlSLSSNELKHLVSLAKKPILTLRKHTSLSEIAWIERTLQLAELQP 80 
15605094    1 MLCTTISGPSFLEAKKQILRSLKECHCFEMRVDLL-SVSCLELKKLMELAPISILAWKKPESCSQADWIDKMQSLAELNP 79 
76789098    1 MLCTTISGPSFLEAKKQILRSLKECHCFEMRVDLL-SVSCLELKKLMELAPISILAWKKPESCSQADWIDKMQSLAELNP 79 
166155456   1 MLCTTISGPSFLEAKKQILRSLKECHCFEMRVDLL-SVSCLELKKLMELAPISILAWKKPESCSQADWIDKMQSLAELNP 79 
237802795   1 MLCTTISGPSFLEAKKQILRSLKECHCFEMRVDLL-SVSCLELKKLMELAPISILAWKKPESCSQADWIDKMQSLAELNP 79 
237804717   1 MLCTTISGPSFLEAKKQILRSLKECHCFEMRVDLL-SVSCLELKKLMELAPISILAWKKPESCSQADWIDKMQSLAELNP 79 
89898096    1 MLCATISGPTFAEAKQQLLQSLPLVDSIELRVDCLlSLSSNQLKHLISLAKKPILTLKKHASLSEIAWIERTMELAKLQP 80 
29840484    1 MLCATISGPSFFEAKQQLLHSLPFVDSIELRIDCLlSLSSDQLKHLVCLAKKPILTLRRHASLSEIAWVERTMELAKLQP 80 
16751990    1 MLCATVSGPSFCEAKQQILKSLHLVDIIELRLDLInELDDQELHTLITTAQNPILTFRQHKEMSTALWIQKLYSLAKLEP 80 
15618943    1 MLCATVSGPSFCEAKQQILKSLHLVDIIELRLDLInELDDQELHTLITTAQNPILTFRQHKEMSTALWIQKLYSLAKLEP 80 
62185307   81 EYLDIDKDFPKEALAKIQKNYPKIKIILSYHSETSEHIPNLCKEMLRQQAHHYKIAITSTKSTDTLRCIQIKKHLPENTT 160
15605094   80 NYLDLEKDFPEEDMIRIRQLHPQIKIIRSLHTSEHTDIIQLYAHMRSSAADYYKFAVSSSSTTDLLDICHQKRSLPENTT 159
76789098   80 NYLDLEKDFPEEDMIRIRQLHPQIKIIRSLHTSEHTDIIQLYAHMRSSAADYYKFAVSSSSTTDLLDICHQKCSLPENTT 159
166155456  80 NYLDLEKDFPEEDMIRIRQLHPQIKIIRSLHTSEHTDIIQLYAHMRSSAADYYKFAVSSSSTTDLLDICHQKRSLPENTT 159
237802795  80 NYLDLEKDFPEEDMIRIRQLHPQIKIIRSLHTSEHTDIIQLYAHMRSSAADYYKFAVSSSSTTDLLDICHQKCSLPENTT 159
237804717  80 NYLDLEKDFPEEDMIRIRQLHPQIKIIRSLHTSEHTDIIQLYAHMRSSAADYYKFAVSSSSTTDLLDICHQKCSLPENTT 159
89898096   81 EYLDIDKDFPKEALTSIQKQYPNIKIILSYHSETSEYAPNLHEEMLKRQAHHYKIAITSTRSIDTLRCIQIKKNLPENTT 160
29840484   81 DYLDIDKDFPKEALRKIRNQYPNIKIILSYHSQTSEHVPTLYNEMLKQQAHHYKIAITSTKSVDALRLIQIKKHLPENTT 160
16751990   81 KWMDIDVSLPKTALQTIRKSHPKIKLILSYHTDKNEDLDAIYNEMLATPAEIYKIVLSPENSSEALNYIKKARLLPKPST 160
15618943   81 KWMDIDVSLPKTALQTIRKSHPKIKLILSYHTDKNEDLDAIYNEMLATPAEIYKIVLSPENSSEALNYIKKARLLPKPST 160
62185307  161 LLCMGNAGIASRILSPLMKNAINYASGIHAPKVAPGQLSIEDLLAYNYTNLSAEARIYGLIGNpVDRSISHLSHNKLFSE 240
15605094  160 VVCLGGMGRPSRILSPILQNPFTYARSTGSSPVAPGQFSLKHHYFYNFASLSAQSPICALIGD-TSRSIGHLTHNPFFSQ 238
76789098  160 VVCLGGMGRPSRILSPILQNPFTYARSTGSSPVAPGQFSLKHHYFYNFASLSAQSPICALIGD-TSRSIGHLTHNPFFSQ 238
166155456 160 VVCLGGMGRPSRILSPILQNPFTYARSTGSSPVAPGQFSLKHHYFYNFASLSAQSPICALIGD-TSRSIGHLTHNPFFSQ 238
237802795 160 VVCLGGMGRPSRILSPILQNPFTYARSTGSSPVAPGQFSLKHHYFYNFASLSAQSPICALIGD-TSRSIGHLTHNPFFSQ 238
237804717 160 VVCLGGMGRPSRILSPILQNPFTYARSTGSSPVAPGQFSLKHHYFYNFASLSAQSPICALIGD-TSRSIGHLTHNPFFSQ 238
89898096  161 LLCMGNAGIASRILSPLMKNAINYAAGINAPNVAPGQLSIADLLAYNYTNLSAESSIYGLIGNpVNRSISHLSHNKLFSE 240
29840484  161 VLCMGNEGIASRILSPLMKNAINYASGIHAPKVAPGQLSIEDLLAYNYANLSSEARIYGLIGNpIDRSISHLSHNKLFSE 240
16751990  161 VLCMGTHGLPSRVLSPLISNAMNYAAGISAPQVAPGQPKLEELLSYNYSKLSEKSHIYGLIGDpVDRSISHLSHNFLLSK 240
15618943  161 VLCMGTHGLPSRVLSPLISNAMNYAAGISAPQVAPGQPKLEELLSYNYSKLSEKSHIYGLIGDpVDRSISHLSHNFLLSK 240
62185307  241 LQLNMSYIKILLAPYELNEFFSLTRDLPFGGLSVTMPFKTAVLEYIDILDPSVQQCQSCNTLVFHNNKIAGYNTDGLGLL 320
15605094  239 LGVACPYIKLPLTPQELPKFFSTIRTQPFLGVSVTSPLKTAVLPFLDKQAPSVKASGSCNTLVIRQGEIEGHDTDGEGLF 318
76789098  239 LGVACPYIKLPLTPQELPKFFSTIRTQPFLGVSVTSPLKTAVLPFLDKQAPSVKASGSCNTLVIRQGEIEGHDTDGEGLF 318
166155456 239 LGVACPYIKLPLTPQELPKFFSTIRTQPFLGVSVTSPLKTAVLPFLDKQAPSVKASGSCNTLVIRQGEIEGHDTDGEGLF 318
237802795 239 LGVACPYIKLPLTPQELPKFFSTIRTQPFLGVSVTSPLKTAVLPFLDKQAPSVKASGSCNTLVIRQGEIEGHDTDGEGLF 318
237804717 239 LGVACPYIKLPLTPQELPKFFSTIRTQPFLGVSVTSPLKTAVLPFLDKQAPSVKASGSCNTLVIRQGEIEGHDTDGEGLF 318
89898096  241 LQIHASYIKILLDSHELKDFFSLTRDLPFQGLSVTMPFKTKVLDYIDILDHSAQHCQSCNTLVFNNHKITGYNTDGLGLF 320
29840484  241 LHMKTSYIKILLSSADLKEFFSLTRDLPFGGLSVTMPFKTDVLDYIDVFDPSVKHCQSCNTLVFNKNKITGHNTDGLGLL 320
16751990  241 LSLNATYIKFPVTIGEVVTFFSAIRDLPFSGLSVTMPLKTAIFDHVDALDASAQLCESINTLVFRNQKILGYNTDGEGVA 320
15618943  241 LSLNATYIKFPVTIGEVVTFFSAIRDLPFSGLSVTMPLKTAIFDHVDALDASAQLCESINTLVFRNQKILGYNTDGEGVA 320
62185307  321 NLLKRKNIPLQNMHVGIVGSGGAAKAIATTFAYSGAQISIFNRTKAHAEKLSVLCHGQAFPLHSLSeHHNIDILILCLP- 399
15605094  319 SVLMQHQIPLNNQRVAIIGAGGAAQSIATRLSRANCELLIFNRTKAHAEDLASRCQAKAFSLEELP-LHRVSLIINCLP- 396
76789098  319 SVLMQHQIPLNNQRVAIIGAGGAAQSIATRLSRANCELLIFNRTKAHAEDLASRCQAKAFSLEELP-LHRVSLIINCLP- 396
166155456 319 SVLMQHQIPLNNQRVAIIGAGGAAQSIATRLSRANCELLIFNRTKAHAEDLASRCQAKAFSLEELP-LHRVSLIINCLPp 397
237802795 319 SVLMQHQIPLNNQRVAIIGAGGAAQSIATRLSRANCELLIFNRTKAHAEDLASRCQAKAFSLEELP-LHRVSLIINCLP- 396
237804717 319 SVLMQHQIPLNNQRVAIIGAGGAAQSIATRLSRANCELLIFNRTKAHAEDLASRCQAKAFSLEELP-LHRVSLIINCLP- 396
89898096  321 NLLKRKHISLQNQHIAIVGSGGAAKAIATTLAREETRISIFNRTQAHAEKLARLCNGQAFPLSSLSeNHNIDMLVLCLP- 399
29840484  321 NLLKRKNIAVHNTHVGIVGSGGAAKAIATTFAYSGACISIFNRTEENGKKLAELCNGNAFPLSSLSeKHAIDILILCLP- 399
16751990  321 KLLKQKNISVNNKHIAIVGAGGAAKAIAATLAMQGANLHIFNRTLSSAAALATCCKGKAYPLGSLEnFKTIDIIINCLP- 399
15618943  321 KLLKQKNISVNNKHIAIVGAGGAAKAIAATLAMQGANLHIFNRTLSSAAALATCCKGKAYPLGSLEnFKTIDIIINCLP- 399
62185307  400 -PGVDIPEIYPPVIIDINTLPKESLYTKKAKERGCQILYGYEMFAEQALLQFSLWFPDKLSQENRERFRLSVENIISTM 477
15605094  397 -PSCTIPKAVAPCVVDINTIPKHSTFTQYARSQGSSIIYGHEMFTQQALLQFRLWFPTLSFKHLEKTFIRRAAVLASLF 474
76789098  397 -PSCTIPKAVAPCVVDINTIPKHSTFTQYARSQGSSIIYGHEMFTQQALLQFRLWFPTLSFKHLEKTFIRRAAVLASLF 474
166155456 398 sPSCTIPKAVAPCVVDINTIPKHSAFTQYARSQGSSIIYGHEMFTQQALLQFRLWFPTLSFKHLEKTFIRRAAVLASLF 476
237802795 397 -PSCTIPKAVAPCVVDINTIPKHSTFTQYARSQGSSIIYGHEMFTQQALLQFRLWFPTLSFKHLEKTFIRRAAVLASLF 474
237804717 397 -PSCTIPKAVAPCVVDINTIPKHSTFTQYARSQGSSIIYGHEMFTQQALLQFRLWFPTLSFKHLEKTFIRRAAVLASLF 474
89898096  400 -PHVEIPEIFPPVIIDINALPKESLYIQKAKNHGSRVLYGYEMFAEQALLQFSLWFPKQLSEYDCERFRSNVESIVNAV 477
29840484  400 -PHVKIPEIFPPVVIDINTLPKESPYTRKAKAQGCHVLYGYEMFAEQALLQFSLWFPRSLSQDDSERFRINVENIVNTM 477
16751990  400 -PEVTFPWRFPPIVMDINTKPHPSPYLERAQKHGSLIIHGYEMFIEQALLQFALWFPDFLTPESCDSFRNYVKNFMAKV 477
15618943  400 -PEVTFPWRFPPIVMDINTKPHPSPYLERAQKHGSLIIHGYEMFIEQALLQFALWFPDFLTPESCDSFRNYVKNFMAKV 477
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap