Conserved Protein Domain Family
PRK09212

?
PRK09212: PRK09212 
pyruvate dehydrogenase subunit beta; Validated
Statistics
?
PSSM-Id: 169719
View PSSM: PRK09212
Aligned: 35 rows
Threshold Bit Score: 594.779
Threshold Setting Gi: 189911041
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225630112   1 MATLSVREALCTAIREEMQNDSDVLIMGEEVAEYDGAYKVTKGLLKEFGENRVVDTPITEHGFAGLAVGAAFAGLKPIVE 80 
108758610   1 MPELMYREALNQALAEEMERDANVYLIGEEVGRYNGAFKVSQGLLDKFGSARIIDAPIAELGFTGLSVGAAMVGLRPVVE 80 
45657761    1 MAVLTYREALNRAMCEEMDKDPNIFLMGEEVGHYDGAYKVSQGMLSKYGEKRVIDTPISENGFAGVGIGAAMVGLRPIIE 80 
24214709    1 MAVLTYREALNRAMCEEMDKDPNIFLMGEEVGHYDGAYKVSQGMLSKYGEKRVIDTPISENGFAGVGIGAAMVGLRPIIE 80 
189911041   1 MAILTYREALNRAMIEEMKQDPLIYLMGEEVGHYQGAYKVSQGMLDLFGEGRVIDTPISENGFAGIGVGSAMVGLRPIIE 80 
116328022   1 MAILTYREALNRAMCEEMDKDPNIFLMGEEVGHYDGAYKVSQGMLAKYGEKRVIDTPISENGFAGVGIGAAMVGLRPIIE 80 
116331525   1 MAILTYREALNRAMCEEMDKDPNIFLMGEEVGHYDGAYKVSQGMLAKYGEKRVIDTPISENGFAGVGIGAAMVGLRPIIE 80 
56417313   11 MALITVREALRQAMEEEMERDPNVLLIGEEVGEYQGAYKVSQGLLERFGPSRVVDTPISEHAFTGIAVGAAFCGLKPIVE 90 
222475676  11 MALITVREALRQAMEEEMERDPNVLLIGEEVGEYQGAYKVSQGLLERFGPSRVVDTPISEHAFTGIAVGAAFCGLKPIVE 90 
88607662    1 MEVITVREALRLAMEEEMERDQSVFLMGEEVGEYQGAYKISQGLLERFGPQRVVDTPISEHGFTGLAVGAAFCGLKPIVE 80 
225630112  81 FMTFNFSMQAIDQIVNSAAKTNYMSGGQLGCPIVFRGPNGAAARVAAQHSQCFAAWYSHIPGLKVIAPYFASDCRGLLKA 160
108758610  81 MMTWNFAILAMDQIVNNAAKLRHMSGGQLRCPIVFRGPGGAGGRLSSQHSQALEANYAHFPGLKVIAPATPADAKGMLKA 160
45657761   81 FMTWNFSLVAIDQIINSAAKMNYMSAGQFPIPIVFRGAGGAGGRLAAQHSQSFESWYAHIPGLKVIAPYTPSDACGLLKT 160
24214709   81 FMTWNFSLVAIDQIINSAAKMNYMSAGQFPIPIVFRGAGGAGGRLAAQHSQSFESWYAHIPGLKVIAPYTPSDACGLLKT 160
189911041  81 FMTWNFSLVAIDQIINSAAKMNYMSGGQFPMPIVFRGAGGAGGRLAAQHSQAFESWYAHCPGLKVVCPATPKDAYGLLKS 160
116328022  81 FMTWNFSLVAIDQIINSAAKMNYMSAGQFPIPIVFRGAGGAGGRLAAQHSQSFESWYAHIPGLKVIAPYTPADACGLLKT 160
116331525  81 FMTWNFSLVAIDQIINSAAKMNYMSAGQFPIPIVFRGAGGAGGRLAAQHSQSFESWYAHIPGLKVIAPYTPADACGLLKT 160
56417313   91 FMSFNFSMQAMDQIVNSAAKTNYMSGGQLGCPIVFRGPNGAAAGVAAQHSQCYASWYAHIPGIKVVAPYFAADCKGMLKA 170
222475676  91 FMSFNFSMQAMDQIVNSAAKTNYMSGGQLGCPIVFRGPNGAAAGVAAQHSQCYASWYAHIPGIKVVAPYFAADCKGMLKA 170
88607662   81 FMSFNFSMQAMDQIVNSAAKTNYMSGGQLGCPIVFRGPNGAAAGVAAQHSQCFASWYSHVPGIKVVAPYFAADCKGLLKS 160
225630112 161 AIRDPNPVIFLENEIAYGHEHEVSDSELSnkdylLEIGKAAVIREGKDVTITAFSLKLMDALNAADLLSSEGIEAEVIDL 240
108758610 161 AIRDENPVLMFEGERLYAIKGEVPEGEHV-----VPLGKADVKREGSDVTIITWSRMYYFCMQAAEELAKEGISVEVLDL 235
45657761  161 AIRDNNPTIFIESEVLYGTRGEVPDQEYS-----IPFGKADIKREGSDITIVSWSRALMYVLPAAEKLSKEGISVEVLDL 235
24214709  161 AIRDNNPTIFIESEVLYGTRGEVPDQEYS-----IPFGKADIKREGSDITIVSWSRALMYVLPAAEKLSKEGISVEVLDL 235
189911041 161 SIRDNNPTIFIESEVLYGMKGEVPEGEFT-----IPLGLGEIKRKGTDITLVTWSRALSFAEEAALILEKEGISVEIVDL 235
116328022 161 AIRDNNPTIFIESEVLYGSRGEVPDQEYS-----IPFGKADLKREGSDITIVSWSRALQYVLPAAERLSQEGISVEVLDL 235
116331525 161 AIRDNNPTIFIESEVLYGSRGEVPDQEYS-----IPFGKADLKREGSDITIVSWSRALQYVLPAAERLSQEGISVEVLDL 235
56417313  171 AIRDPNPVIFLENEIAYGHQHDISEEEQSad-ylVEIGKAAVVREGSDLTVLAFSLQLQYALEAADALMNDGISAEVIDL 249
222475676 171 AIRDPNPVIFLENEIAYGHQHDISEEEQSad-ylVEIGKAAVVREGSDLTVLAFSLQLQYALEAADALMNDGISAEVIDL 249
88607662  161 AIRDPNPVIFLENEIAYGHSHEVTEEQLSkd-slVELGKAAIVREGKDVTIITFSLQLKYALEAAEILLKDNISAEVIDL 239
225630112 241 RTLRPLDTQTVINSIQKTNRLVSVEEGWPFAGIGAELSAVVMEQGFDYLDAPVVRVTGKDIPLPYAANLEKKALPQVEDI 320
108758610 236 RTLRPLDEEAILASVRKTNRAVIVEEGWALAGVGASVVDIIQSKAFDDLDAPVERVTGLDVNMSYAANLENATQPDAPKI 315
45657761  236 RSIRPLDEEAIYTSIRKTNRALVVEEGWEVAGFGSQIAYLIQKNSFDDLDAPVERITQEDVPMPYAANLEKASLPSEEKI 315
24214709  236 RSIRPLDEEAIYTSIRKTNRALVVEEGWEVAGFGSQIAYLIQKNSFDDLDAPVERITQEDVPMPYAANLEKASLPSEEKI 315
189911041 236 RSLRPLDENLIYESVKKTNRAVVVEEGWPVAGFGAQISHLIQKNVFSYLDHPVERVTQMDVPMSYAANLEKMSLPSANRV 315
116328022 236 RSIRPLDEEAIYASVRKTNRALIVEEGWEVAGFGSQVAYLIQKNSFDDLDAPVERITQEDVPMPYAANLEKASLPSEEKI 315
116331525 236 RSIRPLDEEAIYASVRKTNRALIVEEGWEVAGFGSQVAYLIQKNSFDDLDAPVERITQEDVPMPYAANLEKASLPSEEKI 315
56417313  250 RTIRPLDRETILQSVRKTNRLVTVEEGWPFSGVGAEIAAFVTEFAFDDLDAPVLRVAGKEVPLPYAANLEASALPQVGDI 329
222475676 250 RTIRPLDRETILQSVRKTNRLVTVEEGWPFSGVGAEIAAFVTEFAFDDLDAPVLRVAGKEVPLPYAANLEASALPQVSDI 329
88607662  240 RTLRPLDTEAILKSVKKTNRVVTVEEGWPFCGVGAEITALIDECAFDDLDAPVTRVTAKDVPLPYAANLESLALPGVEDI 319
225630112 321 VEAVHQVCFRKK 332
108758610 316 IAAVKKVLYREG 327
45657761  316 ISKVREMLE--- 324
24214709  316 ISKVREMLE--- 324
189911041 316 ADTIREMLR--- 324
116328022 316 IAKVREMLE--- 324
116331525 316 IAKVREMLE--- 324
56417313  330 VSAAHEVCYRKV 341
222475676 330 VSAAHEVCYRKV 341
88607662  320 VSAVHKVCNYSI 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap