Conserved Protein Domain Family
PRK09189

?
PRK09189: PRK09189 
uroporphyrinogen-III synthase; Validated
Statistics
?
PSSM-Id: 169701
View PSSM: PRK09189
Aligned: 24 rows
Threshold Bit Score: 231.084
Threshold Setting Gi: 13473576
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15889909    1 MRIVVTRPQRSGERTAAKLEALGHAPVLLPLFHPIhhgERATSALSDPAGAIAVTSAEALRALATceEQLAPYLSKPLFA 80 
222087477   1 MRVVVTRPQHSGERTVRRLTEMGHEPLPLPLSEPVhdvDAARQALSETQGAIAVTSAEAIRTLAAlgQNIAPHLGRPLFA 80 
222150056   1 MRVLLTRTETASRKTADRLRALGHEPVVLPLAHAIhhvDDTLSALSQPHAALAVTSSEAIRSLAShrEALRGHFETPLFA 80 
227823723   1 MRVLVTRPRPAAERTARKLEAMGHTAIVLPLMQAQhfvAAVRAGFARPHDAIAVTSAEAVRVLAGlgPDLQAHLATPFFA 80 
241206705   1 MRVLVTRPAHSAERTAQRLRDLGHEPLLLPLRQPLhdsAAAAGALAATGSAIAVTSAEAIRVLSAlgEQLHPHLARPLFA 80 
209551272   1 MRVLVTRPAHSAEKTAQRLRDMGHEPLLLPLRQPVhdsTAAAAALARTSGAIAVTSAEAVRVLSAlgEQLRPHFARPLFA 80 
116254225   1 MRVLVTRPAHSATRTAQRLRDMGHEPLLLPLREPLhdsNAAADALAITGGAIAVTSAEAIRVLSAlgEKLHPHLARSLFA 80 
86359486    1 MRVLVTRPAHSATRTAQRLRDMGHEPLLLPLRRPQhdsAAAAGALAATHGAIAVTSGEAARVLSAlgETLPPHLDRPVFA 80 
190893754   1 MRVLVTRPAHSAEKTAQRLREMGHEPLLLPLRRPEhdgAAAAGALAATCGAIAVTSGEAVRVLSAlgETLHPHLDRPIFA 80 
150398164   1 MRVLVTRPRPSAESTAAKLGAMGHETAILPMLQAQhlaDAVLTALSVPHQAIAITSAEAVRVLGSlgPALEPHFGTPLFS 80 
15889909   81 VGGATAEAAQETGFEQIFTASGDALGLTVLVKQHRaflTEEEPLLYLAGRPRGSVFEEGLAAAGIPFRTVDCYEMLPSDI 160
222087477  81 VGKATAKEARILGFTHVLTSEGSGIELAELIAHNRa--GMQQTLLYLAGSPRAAGFETRSTELNIPLRTVECYHMLDITP 158
222150056  81 VGKASASTARALGFRKVLSARGDGAALAEQIAAAPi--AWANPLLYLAGQPRKQSLEHGLRQSSITFRVVDSYTMQGLTY 158
227823723  81 VGAATARVAADLGFRDIRVGAGTGEALAETVAGFLe--PETGSLLYFAGLPRADGFEHALRERGIDHVTVECYRMGAIDH 158
241206705  81 VGETTAEEARSLGFRSVTSSQGNGRDLADLVAT-----QGADGLLYLAGMPRAETFEAGLRELGIRFSIAECYRMQPIVP 155
209551272  81 VGETTAEAARSLGFGSVASSTGNGRDLAELVGA-----QAADGLLYLAGTPRAETFEAGLRQRGIGFSVAECYRMQPVVP 155
116254225  81 VGETTAEEARSLGFRSVASSQGNGRDLADLLAA-----EKPGTLLYLAGTPRAETFERRLRELGIHFSVAECYRMQPTVP 155
86359486   81 VGERTAQAAQRLGFRSVTASSGNGRDLADLVGA-----QRVEDLLYLAGRPRAEIFEGRLRELGIRFSVAECYRMLPVAP 155
190893754  81 VGEMTAQAARRLGFRSVTASSGNGRDLADLVSA-----QSVEDLLYLAGRPRAETFEGRLRELGIRFSVAECYRMLPVAP 155
150398164  81 VGGATARAAGGLGFTDIRTGPGTGEGLAETVAAHL---PAGGALVYLAGSPRTGGFERSLHERRVDYRTAECYRMAPVHY 157
15889909  161 SENTLETTLLDTTADMVLLYSSEAARAFFHHVSaDKYVTALAATKFICISRNVLFLVPEIFRANAKAAEEPSEAAMFELL 240
222087477 159 DDATLRKFFIDTPADAVLFYSRQTALRFFSLPFlRQQPDALAPTRFLCLSEAIADAVPALLRAQSDIAAMPDEDSLLALL 238
222150056 159 HEGDICARLEQKAVDAVLLYSAETARRFFALPLsGKAAGLFASAHIFCLSADIAENVAKPFRNRVSIAPQPREDDLLSLL 238
227823723 159 APETLPALVQSVPFDAVLLYSRETARRLVALIGeSGLDCAGFSARYLCLSASVQDVLPTS--AAADVAAAPDEDRLLGLL 236
241206705 156 GQPEIEAIFSRSRPDAILFYSRQTAEDFFRVPElRSAVPEHSGIRILCLSEAVAEAIPAALKKSVEISPMADEKSLLSLL 235
209551272 156 GQAEIEAIFAGGRPDAVLFYSRQTADDFFGVAElRLALREESGIRLLCLSEAVAQAIPAALKKNAAIAPMPDEKSLLSLL 235
116254225 156 DPAEIDAIFANGYPDAILFYSRQTTEDFFRLPEpRLAPPEHSTARLLCLSEAVAQAIPTALKKSVEISPMADEKSLLSLL 235
86359486  156 GPADIESIFSGHRPDAVLFYSRQTAEDFFQVAElRSALSEQGGIRLLCLSEAVAQAIPTFLKETVAISSMPDEISLLSLL 235
190893754 156 GPAEIAAIFSGRHPDAVLFYSRQTAEDFFQVAElRSALSEQGRIRLLCLSEAVAQAIPTLLRETVTISSMPDEISLLSLL 235
150398164 158 SADTLPELVRAGPFDAVLLYSRETARRLIATLReSRLQPAELASRCLCLSWPIREILPAGFVSE--VAAAPDEENLFRLL 235
15889909  241 HHN 243
222087477 239 TTE 241
222150056     ---    
227823723     ---    
241206705     ---    
209551272     ---    
116254225     ---    
86359486      ---    
190893754     ---    
150398164 236 EAE 238
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap