Conserved Protein Domain Family
PRK09174

?
PRK09174: PRK09174 
F0F1 ATP synthase subunit B
Statistics
?
PSSM-Id: 169692
View PSSM: PRK09174
Aligned: 28 rows
Threshold Bit Score: 242.395
Threshold Setting Gi: 116250701
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82699299    1 MFVSTAFAQTATesQPASTAGEHGAADAVHTETGVAHDAGHGSGVFPPFDSTHYASQVLWLAITFGLFYLFLSRVVLPRI 80 
227821028   1 --MTAAYAQQSTt-TEGAEAHDAPAAGEVHTETGVAHEAEHGSGVFPPFDSSHFASQLLWLAITFGLFYLLMSKVIIPRI 77 
86356512    2 FFVTPAYAEEAPaaATGTDAHAAPAAGEVHTETGVA-EGEHARGPFPPFDSTTYASQLLWLVITFGVFYLLMQKVIAPRI 80 
121602545   1 --------------------------------------------MFPPFDFSHFCSHFFWLVISFGFFYFFIARVIVPRI 36 
49473961    1 MFISSACAQSN-----------------EILVEHIKNASEHADRIFPPFDFVHFGSHFFWLAISFGLFYLFISRVIVPRI 63 
240850061   1 MFVSSAYAQNT-----------------ETSIEHIKKVAEHANRVFPPFDFVHFGSHFFWLAISFGLFYLFISRVIVPRI 63 
49475211    1 MFISSAYAQNT-----------------ETSLEHIKNVAERIDRVFPPFDFVHFGSHLFWLAISFGLFYLFISRVIVPRI 63 
150395674   1 MFVTAAYAQSTT--TEGAEAHDAAAAGEVHTETGVAHEGEHGSGVFPPFDSTHFASQLLWLAITFGLFYLLMSKVIIPRI 78 
15964590    1 MFVTAAYAQSST--TEGAEAHDAAAAGEVHTETGVAHEADHGAGVFPPFDTTHFASQLLWLAITFGLFYLLMSKVIIPRI 78 
13476165    1 MFVTSAFAEETA---------PAVTGGDTHSGTGVPAEA---HGTFPPFDPATFPSQLLWLAITFGLFYLFLKKVAMPRI 68 
82699299   81 GGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELAQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERI 160
227821028  78 GGILEKRHDRIAQDLDEASRLKGEADAAIASYEQELANARAKGHSIADTAREEAKSKATADRAAVEAELTKKITAAETRI 157
86356512   81 GAILDQRHKRISQDLEEAGRLKAEADAAVQTYEGELAAARAKSHAIGSAARDAAKVKAEEDRRTVEASLSEKIKAAEARI 160
121602545  37 GCTIEIRRDRIASDLDRAMRLKQEADTVVEIYERKLAEARLQAYAIAQKTSNEIKEKTKLERKEIETSLDKKLADAEGQI 116
49473961   64 GDVIETRRDRIASDLDQAMRMKQEADTVVETYERKLAQARSQAHVIAQAAGEEIKQKVELERREIEASLEKKLKDAEKQI 143
240850061  64 GGVIETRRDRIASDLDQAMRMKQEADIVVETYERKLAEARLKAHAIAQVASEELKEKAELERKEIEESLEKKLADAEKQI 143
49475211   64 GGVIETRRDRIASDLDQAMRMKQEADIVVETYERKLAQARSQAHVIAQTASEEIKQKVELERKEIEANLEKKLTDAEKQI 143
150395674  79 GSILETRHDRIAQDLDEASRLKGEADAAIAAYEQELAGARAKGHSIADTAREAAKSKAKADRDGVEADLAKKIAAAEARI 158
15964590   79 GGILETRHDRIAQDLDEASRLKGEADAAIAAYEQELAGARAKGHSIADTAREAAKAKAKADRDGVEAGLAKKIAAAEARI 158
13476165   69 GGIIDVRNDRISQDLDQASKLKGEADAAVAAYEQELAEAKKNASSIGQQAADAAKAEAETARKKIEAALDEKLGEAEARI 148
82699299  161 AAIKAKAMSDVGNIAEETTATIVEQLLGLTADKASVSEAVKAIRAS 206
227821028 158 ADIKSKALADVGAIAEETATAVVKQLIGGNVTKTEIAAAVKASAGN 203
86356512  161 ADIKAKAFADVGTIAEETAAAVVEQLIGSTAAQADVAAAVAAAKKE 206
121602545 117 AKIRNKAVQNIGSIAEEVVPEIVKKLIGVEVSKESVSLAVKAADN- 161
49473961  144 AKIRDKAMQNVGSIAEEAALEIVKKMIDVDVSRESVRSAVKAAGY- 188
240850061 144 AKIRDKAMQNVGSIAEEVALEIVKKLIDVDISKEAVRSVVKTADY- 188
49475211  144 AKIRDKAMKSVGSIAEEVALEIVKKLIDVEVSKESVRSAVKATGY- 188
150395674 159 GDIKSKALADVGAIAEETATAIVKQLIGGTVTKSEIAAAFKASAGN 204
15964590  159 ADIKSKALADVGAIAEETATAVVKQLIGGTVTKAEIAAAFKASAGN 204
13476165  149 SSIKANAMKEVGSIAEDTASAIVEALVGGKASKAEIAAAVKSVAR- 193
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap