Conserved Protein Domain Family
PRK09173

?
PRK09173: PRK09173 
F0F1 ATP synthase subunit B; Validated
Statistics
?
PSSM-Id: 169691
View PSSM: PRK09173
Aligned: 29 rows
Threshold Bit Score: 162.217
Threshold Setting Gi: 15888061
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49473962    1 MTDTFWAFVGLVLFLALLAYFKVPEMIVHRLDARAKRIKDELDEALRLREEAQEVLAEYQRKHAEAEKDAQEIIAAAKRE 80 
222147704   3 YDATFFAFVGLVLFLALIAYLKVPGMMAKSLDARADNIRDELAEAKRLREEAQQLLAEYRAKRKQAEAEAQAIVTAAERE 82 
86356513    5 FDATFFAFVGLILFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEYQRKRKEAEAEAAHIVAAAERE 84 
190890578   5 LDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEYQRKRKEAEAEAAHIVAAAERE 84 
241203304   5 FDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEYQRKRKEAEAEAAHIVAAAERE 84 
209548121   5 FDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEYQRKRKEAEAEAAHIVAAAERE 84 
116250702   4 LDATFFAFVGLVLFLALVVYLKVPGMMAKSLDDRADQIRNELAEAKRLREEAQHLLVEYQRKRKEAEAEAAHIVAAAERE 83 
240850062   1 MTDTFWAFVGLVLFLALLVYFQIPQRVIHHLDARAKRIKDELDEALRLREEAQEILAEYQRKHAEAEKDAQEIIAAAKHE 80 
49475212    1 MTDTFWAFVGLVLFLALLVYFEVPEMVLRHLDTRAKRIKDELDEALRLREEAQEVLAEYQRKHAEAEKDAQEIIAAAKRE 80 
163867854   1 MSDTFWAFVGLVLFLALLVYFQIPQKIIHHLDARAKRIKDELDEALRLREEAQEILAEYQRKHAEAEKDAQEIIAAAKHE 80 
49473962   81 VEAVVSEARTKAEEYVKNRNKLAEQKIAQAEADAIRVVSSSAVDLAVSAARVLIEQELDSNKANELIKESLFEesltkMK 160
222147704  83 AAALTEEARQKTEEFVQRRNALSEQKIKQAETDAINAVRSAAVDLAISAAETLLKQKVDAQLQSGLFNSSVSE-----VK 157
86356513   85 AEMLTAEAKKKTEEFVANRTALSEQKIKQAEADAMKAVRSAAVDLAIAAAETVLAKKADGKVQSELFGNAVGQ-----VK 159
190890578  85 AEMLTADAKKKTEEFVANRTALSEQKILQAEAEAMKAVRSAAVDLAIAAAETVLAKQADAKVQSELFGNAVSQ-----VK 159
241203304  85 AEMLTAEAKKKTEEFVANRTALSEQKIKQAEVEAMKAVRSAAVDLAIAAAETVLAKRADTKIQSELFGNAVGQ-----VK 159
209548121  85 AQMLTAEAKKKTEEFVANRTALSEQKIKQAEVEAMKAVRSAAVDLAIAAAETVLGKQADAKVQSELFGNAVGQ-----VK 159
116250702  84 AEMLTAEAMKKTEEFVANRTALSEQKIKQAEVEAMKAVRSAAVDLAIAAAETVLAKRADAKVQSELFGNAVGQ-----VK 158
240850062  81 VESVIAEARTKAEEYVKNRNKLAEQKIAQAEADAIRMVSSSAIDLAISTARILIAKELDSNKADELIKESLEKesfikMK 160
49475212   81 VEAVISEARIKAEEYVKNRNKLAEQKIAQAEADAIRMVSSSAIDLAVSAARVLIEKELDSHKANELIKESLVQesltkMK 160
163867854  81 VESVIAEARTKAEEYVKNRNKLAEQKIAQAEADAIRMVSSSAIDLAISTARVLIAKELDSNRADELVKEALSKeslskMK 160
49473962  161 AYLN 164
222147704 158 NRLN 161
86356513  160 TRLN 163
190890578 160 TRLN 163
241203304 160 TRLN 163
209548121 160 TRLN 163
116250702 159 TRLN 162
240850062 161 TYLN 164
49475212  161 TYLN 164
163867854 161 THLN 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap