Conserved Protein Domain Family
PRK09112

?
PRK09112: PRK09112 
DNA polymerase III subunit delta'; Validated
Statistics
?
PSSM-Id: 169667
View PSSM: PRK09112
Aligned: 29 rows
Threshold Bit Score: 546.943
Threshold Setting Gi: 13470653
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82699844    2 IEELDIPKTHDAIEGVPGPSASAYLAGHDEIARFLAQAYHEGRMHHALLFEGPQGIGKATLAFHLAGHMLSFGDRNEAPE 81 
222148590   1 MSEGARMEKPGLLDGAIAPFANDRMFGHGAAEQFLASSYQSGKLHHAILIEGPEGIGKATLAFRFAHHVLSHPDPASAPF 80 
227822154   1 ----MTMERPGVLEGAVAPVENSKLFGHREAEAFLAQSYRSGKGHHAILIEGPEGIGKATLAFRFANHVLSHPEPAEAPE 76 
121602540   1 MNDINFLRQHDDIEGILSPLQNNIIIGHEEVRHFLAQLRKEKRLHHALLFEGERGIGKATLAFHFAWNILS-----NQEN 75 
49474219    1 MNDINFLRQYNDIDTVLSPSQNNIIFGHEAARHFLAQMRQEGRLHHALIFEGEHGIGKATLAFHLAWNILS-----SQKG 75 
240850632   1 MSNVNILRQYDDIDTILSPSQNDVVFGHEDVRHFLTQMLKEERLHHALLFEGEYGIGKATLAFHLAWNILS-----SQQD 75 
49475611    1 MSDVIFLRQYDDIDIVSSPSQNNIIFGHEAARHFLAQILKEERLPHAILFEGDYGIGKATLAFHLAWNILS-----SQKD 75 
150396509   1 ----MSVEHSAVLEGALAPAMNSRLFGHQEAEAFLAQSYKSGKGHHAILIEGPEGIGKATLAFRFANHILSHPEPAEAPS 76 
15965356    1 ----MTAEQPRVLEGALAPATNSKLFGHQEAEAFLAQSYRSGKGHHAVLIEGPEGIGKATLAFRFANHILSHPDPADAPE 76 
13470653    2 IFERIAPEQHDTLDGVPEPSETPRLVGHGQAAEMLAAAYRSGKLPHALIFAGPVGIGKATLAFHLAHHLLKHPAFEQAPE 81 
82699844   82 TLIAPDFSKPLWRQIAGGMHPAVLHITRPFDQKTGKFRTAITVEEIRRVTHFLTRTASDHAWRIVIVDPADDMNRNAANA 161
222148590  81 VIADPDPNSLVGRQIASGASHNLLHIARPVDEKTGRVKSSITVEEIRKAGHFFSQTSGGGNWRIVILDPADDMNRNAANA 160
227822154  77 HLGDPDPASLVTRQLASGASHNLLHLARPVDEKTGRAKGAITVDEVRRAGKFFGQTSGTGNWRIVIIDPADDLNRNAANA 156
121602540  76 GFLQPEYDSVIWRQIAQGSHPNLVYVARRFDSKTKKFKTGISIDDIRNMMYFLKQTSRNGEWRVVIIDPADDMNRNAANA 155
49474219   76 DFLQPESNSITWRQITQGSHPCLLHISRRFDVKTQKFKTGILIDDIRDIMHFLHKTSQDNGWRIVIIDPADDMNRSAANA 155
240850632  76 AFLKPDPYSTPWRQITQGSHPGLLYISRRFDVKTQKFKTGILVDDVRDIMHFLSRTSQDNGWRIVIIDSADDMNRNAANA 155
49475611   76 GFKQPEHNSVIWRQITQGSHPGLLHISRRFDVKTQKFKTGILFDDIRDIIHFLNRTSKDSGWRIVIIDPADDMNRNAANA 155
150396509  77 RLADPDPESIITRQLASAASHNLLHLARPVDEKTGRAKGAITVDEVRRAGKFFGQTSGTGNWRIVIVDPADDLNRNAANA 156
15965356   77 RLADPDPASMVTRQLASGASHNLLHLARPVDEKTGRAKGAITVDEVRRAGKFFGQTSGTGNWRIVIIDPADDLNRNAANA 156
13470653   82 RLANPDPASPLFRQIATGAHPGVLHLTRPMNDKTKSFKTVVTVDEIRRVSRFLSMTSHDGSYRVVIVDPADDMNANAANA 161
82699844  162 LLKTLEEPPARALFILISHSSGRLLPTIRSRCQSISFKPLDGETLGRALSHAGSKAGiSAGDITEVLLQRSEGSVRKALL 241
222148590 161 ILKVLEEPPKRSLFLVLSHAPGKLLPTIRSRCMPLKLQTLGVDDLASALAHLGVSPP---VEQMAALSDLSKGSVSQALK 237
227822154 157 ILKILEEPPRRSLFLVLTHAPGKLLPTIRSRCLPLRLKPLEPEPMRLALAHLGFDLT---GPNAEGIIAAASGSVSEALK 233
121602540 156 ILKTLEEPPEKTLFIIITHSSRKLLSTIRSRCQQVLLRSLHDDEMKQVISHIIPKQAlSDEETVKMIIQKSEGRPRKAAL 235
49474219  156 ILKTLEEPPAKTLFIIITHSSGKLLPTIRSRCQQISLRPLHDDEMKKVITHVFFNQNrLNEETIKMIVQRSKGSPRKAAL 235
240850632 156 ILKILEEPPSKTLFVIIAHSSGKLLPTIHSRCQKISFRPLNNDEMKKVIIHIFANQNlPDEKTIEIIIKKSKGSPRKAAL 235
49475611  156 ILKTLEEPPAKTLFIIITHFSGKLLPTIRSRCQQISLRPLHNDEMKKIIIHMFSNQNvIDEENIGMIIQKSNGNPRKAAL 235
150396509 157 ILKMLEEPPPRSLFLVLTHAPGRLLPTVRSRCLPLRLKPLETADLRQALTHLGVDLA---GPNAGRVLAAASGSVSEALK 233
15965356  157 ILKMLEEPPRRSLFLVLTHAPGKLLPTIRSRCLPLRLKPLDTQALRQALAHLGLDLA---GPDAERVLAAASGSVSEALK 233
13470653  162 LLKNLEEPPARTLFILIVHAPGSLLPTIRSRCQVIRLTPLDADDLLAVLETAEPPPP-DDPAARAALVERAGGSARNAIL 240
82699844  242 LLAHGGLEISDTVDQIIAGSIFDLPKA-QALGGILNGREAEVQYELFRDYLMGRIAAEARRYADSGQLREADQWARFWSD 320
222148590 238 LINYGGMEIIAAFNAILASEGPAARKQmHKLADALSAKDSDVIYHFFIEHLSEFLMDNARQVAMAGDLARAERLSRLSSA 317
227822154 234 LINYGGLDIAAAFEDVLAGQGPAVRKQvHKLADILSAKDSETIYDFFSSLFMGRVMRLAREAAIAGDIGRAERFATLSGS 313
121602540 236 LISYGGFEIAKTLDNLFKQSTCNLAIV-HNLAQALSSFDLDIQFQQFCDEILDRIQKKAILFAEQGALALSKKYAQIWQN 314
49474219  236 LIHHGGLEIVKNIDTLLEQSVCNPAIV-HTLAQTLSSLSSVIQFQQFCNEILDKIQKKAIMLAEKGNLALSKKYAQIWQE 314
240850632 236 LICHDGLEIIKTIDVLLEKPVCNATIV-HTLAQTFSSVSSTFQFQQFCDEILNKIQKKAIMLVEKGDLFLSKKYAEKWQE 314
49475611  236 LI-HGGFEIIKTIDTLLGQSVCNPTIV-HNLAQTLSSLSSVIQFQQFCDEILDKIQKKAIMLAERGNLALSKKCAQAWQE 313
150396509 234 LVNYGGLDIAEAFEDILAGQGPGSRKSmHKLADVLSGRDSETIFDFFSSLLAGRIMQLAREAAIAGDVGRAERFARLSSS 313
15965356  234 LINYGGLDIAGAFDDILAGQGPAARKNmHKLADVLSGKDSETIFDFFSSLLSGRIMQLAREAAIAGDVGRAERFARLSSS 313
13470653  241 LTQYGGLEIAGTLDALVAKGKSDIGGA-YRLAEAVAGRDQTIQFDIFNRRALDLLSDAASQAALSGDLARAKILSDTWHE 319
82699844  321 LIRETVEAETYNLDRRQSVVILLEKTHRAFRTG 353
222148590 318 IIEKLGVAGAYNLDRKQTLLEILGEVAAV---- 346
227822154 314 LTERLTLSEAYNLDRKQTILSLLDDLKDAL--- 343
121602540 315 IHQEILEMQLFNLDKKQFIINLLFKIHKIIQQT 347
49474219  315 IHQEVEEMQSFNLDKKQFIINLLFRVHKIIHES 347
240850632 315 IHQEIEEIQLFNLDKKQFVINLLFKVHKIIHED 347
49475611  314 IHQEIGEIQSFNLDKKQFIINLLFRVHKIICES 346
150396509 314 VGERLALSSAYNLDRKQTILSLLDDLKEAL--- 343
15965356  314 VGERLAVSNAYNLDRKQTILSLLDDLKDAL--- 343
13470653  320 ALDAISETDTYNLDKKQHALTMIDRLKSVM--- 349
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap