Conserved Protein Domain Family
PRK09099

?
PRK09099: PRK09099 
type III secretion system ATPase; Provisional
Statistics
?
PSSM-Id: 169656
View PSSM: PRK09099
Aligned: 28 rows
Threshold Bit Score: 753.912
Threshold Setting Gi: 53716417
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21230693    1 MLAEMPLLQTTLERELAALAFGRRYGKVVEVIGTMLKVAGVQVSLGEVCELRQRDGTLLQRAEVVGFSRTLALLAPFGEL 80 
66769312    1 MLAEMPLLQTTLERELAALAFGRRYGKVVEVIGTMLKVAGVQVSLGEVCELRQRDGTLLQRAEVVGFSRTLALLAPFGEL 80 
188992464   1 ----MPLLQTTLERELAALAFGRRYGKVVEVIGTMLKVAGVQVSLGEVCELRQRDGTLLQRAEVVGFSRTLALLAPFGEL 76 
58579714    1 MLAETPLLETTLERELATLAFGRRYGKVVEVVGTMLKVAGVQVSLGEVCELRQRDGTLLQRAEVVGFSRDLALLAPFGEL 80 
84621742    1 MLAETPLLETTLERELATLAFGRRYGKVVEVVGTMLKVAGVQVSLGEVCELRQRDGTLLQRAEVVGFSRDLALLAPFGEL 80 
188574355   1 MLAETPLLETTLERELATLAFGRRYGKVVEVVGTMLKVAGVQVSLGEVCELRQRDGTLLQRAEVVGFSRDLALLAPFGEL 80 
21241185    1 MLAEMPLLETALERELATLAFGRRYGKVVELVGTMLKVAGVQVSLGEVCELRQRDGTLLQRAEVVGFSRDLALLAPFGEL 80 
78045988    1 MLAETPLLETTLERELATLAVGRRYGKVVEVVGTMLKVAGVQVSLGEVCELRQRDGTLLQRAEVVGFSRDLALLAPFGEL 80 
120609166   3 DVNGTARIARWMEREIAAAPLVRRSGKVAEVIGTLMRVNGLDAKLGELCHVLDERGELLQAAEVVGFANGQSILSPFGSI 82 
17549091    1 --MTHLALLDSLESAARTTPLIRRFGKVVEVTGTLLRVGGVDVRLGELCTLTEADGTVMQEGEVVGFSEHFALVAPFSGV 78 
21230693   81 VGLSRQTRVIGLGRPLAVPVGSALLGRVLDGLGEPADGQGPLAGDDWVQIQAQAPDPMRRRLIEQPLPTGVRIVDGLMTL 160
66769312   81 VGLSRQTRVIGLGRPLAVPVGSALLGRVLDGLGEPADGQGPLAGDDWVQIQAQAPDPMRRRLIEQPLPTGVRIVDGLMTL 160
188992464  77 VGLSRQTRVIGLGRPLAVPVGSALLGRVLDGLGEPADGQGPLAGDDWVQIQAQAPDPMRRRLIEQPLPTGVRIVDGLMTL 156
58579714   81 IGLSRETRVIGLGRPLAVPVGAALLGRVLDGLGEPSDGQGAIACDTWVPIQAQAPDPMRRRLIEHPMPTGVRIVDGLMTL 160
84621742   81 IGLSRETRVIGLGRPLAVPVGAALLGRVLDGLGEPSDGQGAIACDTWVPIQAQAPDPMRRRLIEHPMPTGVRIVDGLMTL 160
188574355  81 IGLSRETRVIGLGRPLAVPVGAALLGRVLDGLGEPSDGQGAIACDTWVPIQAQAPDPMRRRLIEHPMPTGVRIVDGLMTL 160
21241185   81 VGLSRETRVIGLGRPLAVPVGPALLGRVLDGLGEPSDGQGAIACDTWVPIQAQAPDPMRRRLIEQPMPTGVRIVDGLMTL 160
78045988   81 IGLSRETRVIGLGRPLAVPVGPALLGRVLDGLGEPSDGQGAIACDTWVPIQAQAPDPMRRRLIEHPMPTGVRIVDGLMTL 160
120609166  83 LGVRGGSPVVGLGEVLSVPVGPRLLGRVIDSLGQPIDGKGPLDCSETRPVFALPPTPMEREMIEHPLPTGVKAIDGLITL 162
17549091   79 TGLSRSTRVVPSGRALSVGIGPGLLGRVLDGLGRPADGGPPLDVVEYVPVFANAPDPMTRRLVEHPLATGVRVIDGLATL 158
21230693  161 GEGQRMGIFAAAGVGKSTLIGMFARGTQCDVNVIVLIGERGREVREFIEMILGPDGLARSVVVCATSDRSSIERAKAAYV 240
66769312  161 GEGQRMGIFAAAGVGKSTLIGMFARGTQCDVNVIVLIGERGREVREFIEMILGPDGLARSVVVCATSDRSSIERAKAAYV 240
188992464 157 GEGQRMGIFAAAGVGKSTLMGMFARGTQCDVNVIVLIGERGREVREFIEMILGPDGLARSVVVCATSDRSSIERAKAAYV 236
58579714  161 GEGQRMGIFAAAGVGKSTLMGMFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYV 240
84621742  161 GEGQRMGIFAAAGVGKSTLMGMFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYV 240
188574355 161 GEGQRMGIFAAAGVGKSTLMGMFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYV 240
21241185  161 GEGQRMGIFAAAGVGKSTLMGMFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYV 240
78045988  161 GEGQRMGIFAAAGVGKSTLMGMFARGTQCDVNVIVLIGERGREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYV 240
120609166 163 GEGQRMGIFAPAGVGKSTLMGMLARGTQCDVSVIALIGERGREVREFVEFILGEEGMARSVVVCATSDRSSSERAKAAHV 242
17549091  159 AEGQRMGIFAPAGVGKSTLMGMFARGTECDVNVIVLIGERGREVREFIEQILGEEGMRRSVVVCATSDRSAVERAKAAYV 238
21230693  241 GTAIAEYFRDRGMRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAGMGETGSITAFYTVLAEDDT 320
66769312  241 GTAIAEYFRDRGMRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAGMGETGSITAFYTVLAEDDT 320
188992464 237 GTAIAEYFRDRGMRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAGMGETGSITAFYTVLAEDDT 316
58579714  241 GTAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAGMGESGSITAFYTVLAEDDT 320
84621742  241 GTAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAGMGESGSITAFYTVLAEDDT 320
188574355 241 GTAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAGMGESGSITAFYTVLAEDDT 320
21241185  241 GTAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAGMGESGSITAFYTVLAEDDT 320
78045988  241 GTAIAEYFRDRGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAGMGESGSITAFYTVLAEDDT 320
120609166 243 ATAVAEYYRDQGLKVLLMMDSLTRFARAQREIGLAAGEPPARRGFPPSVFAEIPRLLERAGMGARGSITALYTVLYEDES 322
17549091  239 GTAVAEYFRDQGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERAGMSAAGSITALYTVLAEDES 318
21230693  321 GSDPIAEEVRGILDGHLILSREIAARNQYPAIDVLGSLSRVMSQIVSAEQRQYAGQLRRLLAKHNEVETLLQVGEYRHGS 400
66769312  321 GSDPIAEEVRGILDGHLILSREIAARNQYPAIDVLGSLSRVMSQIVSAEQRQYAGQLRRLLAKHNEVETLLQVGEYRHGS 400
188992464 317 GSDPIAEEVRGILDGHLILSREIAARNQYPAIDVLGSLSRVMSQIVSAEQRQYAGQLRRLLAKHNEVETLLQVGEYRHGS 396
58579714  321 GSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLSRVMSQIVPSDHSQAAGRLRRLLAKYNEVETLVQVGEYRQGS 400
84621742  321 GSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLSRVMSQIVPSDHSQAAGRLRRLLAKYNEVETLVQVGEYRQGS 400
188574355 321 GSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLSRVMSQIVPSDHSQAAGRLRRLLAKYNEVETLVQVGEYRQGS 400
21241185  321 GSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLSRVMSQIVPSDHSQAAGRLRRLLAKYNEVETLVQVGEYRQGS 400
78045988  321 GSDPIAEEVRGILDGHLILSREIAAKNQYPAIDVLASLSRVMSQIVPYDHSQAAGRLRRLLAKYNEVETLVQVGEYRQGS 400
120609166 323 GNDPISEEVRGILDGHMILSRKIAARNQYPAIDVLGSLSRVMSQIVPREHQQAGGRFRQLMAKYEEIEPLVQMGEYRPGN 402
17549091  319 GNDPVAEEVRGILDGHLILSRDIAARNRYPAIDILNSLSRVMTQVMPRDHCDAAGRMRQLLAKYNEVETLLQMGEYKEGS 398
21230693  401 DAVADEAIARIDAIRDFLSQPTDQLSDYDTILEQLAGVIDD 441
66769312  401 DAVADEAIARIDAIRDFLSQPTDQLSDYDTILEQLAGVIDD 441
188992464 397 DAVADEAIARIDAIRDFLSQPTDQLSDYDTILEQLAGVIDD 437
58579714  401 DAVADEAINRIDAIRDFLSQPTDQLSDYESTLEQLANVTDD 441
84621742  401 DAVADEAINRIDAIRDFLSQPTDQLSDYESTLEQLANVTDD 441
188574355 401 DAVADEAINRIDAIRDFLSQPTDQLSDYESTLEQLANVTDD 441
21241185  401 DAVADEAIDRIDAIRDFLSQPTDRLSAYESTLEQLASVTDD 441
78045988  401 DAVADEAIDRIDAIRDFLSQPTDQLSAYENTLELLTSVTDD 441
120609166 403 DPLADEAMEKHAAIRDFLNQSTSDLWDFGRSVDTLADISG- 442
17549091  399 DPVADAAVQWNDWMESFLRQRTDEWCSPDETRRLLDEIALA 439
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap