Conserved Protein Domain Family
PRK09087

?
PRK09087: PRK09087 
hypothetical protein; Validated
Statistics
?
PSSM-Id: 169652
View PSSM: PRK09087
Aligned: 26 rows
Threshold Bit Score: 369.774
Threshold Setting Gi: 13476596
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148559701   1 MHDAPRQIPLNLEHQPGYNREDLIVTASNRAAVDLIDRWPNWLSPVTILAGPTGAGKTHLAEIWRSGTDALLVDPSNITE 80 
161618684   1 MHDAPRQIPLNLEHQPGYNREDLIVTASNRAAVDLIDRWPNWLSPVTILAGPTGAGKTHLAEIWRSGTDALLVDPSNITE 80 
256369148   1 MHDAPRQIPLNLEHQPGYNREDLIVTASNRAAVDLIDRWPNWLSPVTILAGPTGAGKTHLAEIWRSGTDALLVDPSNITE 80 
17987521    1 MHDAPRQIPLNLEHQPGYNREDLIVTASNRAAVDLIDRWPNWLSPVTILAGPTGAGKTHLAEIWRSGTDALLVDPSNITE 80 
225852234   1 MHDAPRQIPLNLEHQPGYNREDLIVTASNRAAVDLIDRWPNWLSPVTILAGPTGAGKTHLAEIWRSGTDALLVDPSNITE 80 
121602210   1 MNEREVQLPLDLPYESVFCFDNLVVTDSNRMAFQLIDNWPNWILPIAILVGKEGSGKTHFSSVWAQKANALTVDREDIDR 80 
49474323    1 MNERETQLPLDFSYNPVFQFDDLVVTESNRMAFQLIDHWPNWILPIAVLVGKEGSGKTHFSSIWAQKTDALRLHRNEIDQ 80 
240850719   1 MNGRETQLSLNFPYDPIFQFEDLVVTESNRMAFQLIDHWPNWSLPIAVLVGKEGSGKTHFSNIWLQKADAFRIQHNEIDQ 80 
49475708    1 MNKRETQLPLNFSYNPIFQFDDLVVTESNRMAFQLIDHWPNWILPIAVLVGKEGSGKTHFSSVWAEKADALRFHRNEIDQ 80 
13476596    5 RTDPPRQLPLDLGHGTGYSRDELVVSGTNNQAAALVDRWPDWPSPVVVLAGPAGSGKTHLAAIWRARANAVAVDARRIG- 83 
148559701  81 EAVNSAAERPVLIDNIGAEAFDETGLFHLINSVRQHaaqgpGPSLLMTSRLWPANWNVKLPDLASRLKAATVVEIAEPDD 160
161618684  81 EAVNSAAERPVLIDNIGAEAFDETGLFHLINSVRQHaaqgpGPSLLMTSRLWPANWNVKLPDLASRLKAATVVEIAEPDD 160
256369148  81 EAVNSAAERPVLIDNIGAEAFDETGLFHLINSVRQHaaqgpGPSLLMTSRLWPANWNVKLPDLASRLKAATVVEIAEPDD 160
17987521   81 EAVNSAAERPVLIDNIGAEAFDETGLFHLINSVRQHaaqgpGPSLLMTSRLWPANWNVKLPDLASRLKAATVVEIAEPDD 160
225852234  81 EAVNSAAERPVLIDNIGAEAFDETGLFHLINSVRQHaaqgpGPSLLMTSRLWPANWNVKLPDLASRLKAATVVEIAEPDD 160
121602210  81 VISLVSSGKSLLIENIDAGQISETGLFHLINSIQQAnldarQTNLLITARTVPSTWNLKLNDLKSRLNSVMLVAINQPDD 160
49474323   81 AIAIGSSGKSFLIEDIDAGEISETGLFHLINNVKQAnldtrQATLLITARTVPSAWNLKLNDLKSRLNSVMLVKINQPDD 160
240850719  81 AVTMASLGRSFLIEDIGAGEINETELFHLINSIKQAnldarQATLLMTARTLPSAWNLKLNDLKSRLNSVMFVEINQPDD 160
49475708   81 AIAVASSGRSFLIEDIDLGEISETGLFHLINSVKQAnldmcQATLLMTARTVPSTWNLKLNDLKSRLNSIMLVAINQPDD 160
13476596   84 DSIAGLGARPALIDDVDAGAVDEQGLFHLINAVRGA-----GSTLLLTARRFPSAWGVSLPDLASRLKAAATVEIHEPDD 158
148559701 161 MLLSGVIHKLFADRQVSVEPHVVSYLVSRMERSLLSAIQIVDRLDRAALEQKSRITRALAAQILADMGQAG 231
161618684 161 MLLSGVIHKLFADRQVSVEPHVVSYLVSRMERSLLSAIQIVDRLDRAALEQKSRITRALAAQILADMGQAG 231
256369148 161 MLLSGVIHKLFADRQVSVEPHVVSYLVSRMERSLLSAIQIVDRLDRAALEQKSRITRALAAQILADMGQAG 231
17987521  161 MLLSGVIHKLFADRQVSVEPHVVSYLVSRMERSLLSAIQIVDRLDRAALEQKSRITRALAAQILADMGQAG 231
225852234 161 MLLSGVIHKLFADRQVSVEPHVVSYLVSRMERSLLSAIQIVDRLDRAALEQKSRITRALAAQILADMGQAG 231
121602210 161 ALLTAVAFKLFSDRQIAVHSDIIHYLVTRCERSLFALQRVVDSVDRLALQRKSKITRTVIGEAINMQMQ-- 229
49474323  161 ALLTAVAFKLFSDRQIIVHPDTVYYLVSRCERSLFSLKHVIDSVDRLALQRKSKITRAVIGEVLNMQIQ-- 229
240850719 161 ALLTAVAFKLFSDRQLIVHPDTVYYLVSRCERSLFSLKRVIDSVDQLALQRKRKITRAIIAEVLNRRNP-- 229
49475708  161 ALLTAVAFKLFSDRQITVHPDTVYYLVNRCERSLFSLKRVIDSVDRLALQRKSKITRAVIGEVLNMQVQ-- 229
13476596  159 LLLAGVITKLFADRQVEVEPHVVQYLVRRIERSLATAMRVVERLDRTALERKMPITRALAAETVSAMDEGQ 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap