Conserved Protein Domain Family
PRK08955

?
PRK08955: PRK08955 
glyceraldehyde-3-phosphate dehydrogenase; Validated
Statistics
?
PSSM-Id: 169599
View PSSM: PRK08955
Aligned: 42 rows
Threshold Bit Score: 676.449
Threshold Setting Gi: 54309386
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113968880   1 MAIKIGINGFGRMGRLALRAAWEWDDVEFVQINDPAGDAATLAHLLEFDSVHGRWRYPVTASHDGIQIQDKTIHTTGNKT 80 
218710930   1 MTVKVGINGFGRIGRLALRAAFDWAEIEFVQINDVAGDTATLAHLLEFDSVQGRWNHEVAVEGDEMIINGQRIRTTQERD 80 
156972644   1 MTIKVGINGFGRIGRLALRAAFDWPELEFVHINDVAGDAATLGHLLEFDSVQGRWNHAVQVEGTDMMINGKRITTSQERD 80 
28899744    1 MTIKVGINGFGRIGRLALRAAFDWPELEFVQINDVAGDAATLSHLLEFDSVQGRWHHEVQVEGNELVINGKRIATTQHRD 80 
37678284    1 MTIKVGINGFGRIGRLAMRAAFDWPELEFVLINDVAGDATTLGHLLEFDSVQGRWHHEVTVQGQQLHINGHVIETTQQRD 80 
27364560    1 MTIKVGINGFGRIGRLAMRAAFDWPELEFVLINDVAGDSTTLGHLLEFDSVQGRWHHEVTVQGQQLHINGHVIETTQQRD 80 
262392900   1 MTIKVGINGFGRIGRLALRAAFDWPELEFVQINDVAGDAATLGHLLEFDSVQGRWHHEVQVEGNELVINGKRIATTQQRD 80 
120556542   2 SKIKVGINGFGRIGRLALRAAWGWPEFEFVAINDPGADTHTLAHLLNFDSVHGTWSREAMADGDDMLIDGQRIRVTHNKA 81 
209696222   1 MTIKVGINGFGRIGRLALRAAFDWPELEFVQINDVAGDAHTLAHLLEFDSIQGRWNHAVTTDGNTMIIGDQKLITTQEKE 80 
59712967    1 MKIKVGINGFGRIGRLALRAAFDWPELEFVQINDAAGDAHTLAHLLEFDSVQGRWHHEVISNGSDMIIAGQTLKTTQEKD 80 
113968880  81 IAETDWSGCDVVIEASGVMKTKALLQAYLDQGVKRVVVTAPVKEEGVLNVVMGVNHQLYDPTIHPIVTAASCTTNCLAPV 160
218710930  81 IDAIDWSGCDVVLEATGVHRKASFLNKYLEQGVKRVVVSAPVKEEGIANIVVGVNDNIFDPAVHKIVTAASCTTNCLAPV 160
156972644  81 IDAVNWGQCDVVIEATGVHRKTSFLNKYLEQGVKRVVVSAPVKEDGVANIVVGVNDHIFDPAQHRIVTAASCTTNCIAPV 160
28899744   81 IDAVNWSGCDVVIEATGVHRKTSYLDQYLDQGVKRVVVSAPVKEEGIANIVVGVNDHIFDPDKHRIVTAASCTTNCIAPV 160
37678284   81 ISAVDWSGCDVVIEATGVHRKSRFLNQYLEQGVKRVVVSAPVKEEGIANIVVGVNDEIFNPEQHRIVTAASCTTNCIAPV 160
27364560   81 ISAVDWSGCDVVIEATGVHRKSRFLNQYLEQGVQRVVVSAPVKEEGIANIVVGVNDEIFNPEQHRIVTAASCTTNCIAPV 160
262392900  81 IDAVNWSGCDVVIEATGVHRKTSYLDQYLDQGVKRVVVSAPVKEEGIANIVVGVNDHIFDPEKHRIVTAASCTTNCIAPV 160
120556542  82 IAETDWSGCDLVIEASGVNKKVAVLQGYLDQGVKRVVVTAPVKESGAKNIVLGVNEHIFDPANDRIITAASCTTNCLAPV 161
209696222  81 IDAVDWSGCDVVIEATGVHRSRSFLDKYLVQGVKRVVVSAPVKEDGVANIVVGVNDDIFDPVIHQIVTAASCTTNCLAPI 160
59712967   81 IDAVDWSGCDVVIEATGVHRKRVFLDKYLAQGVKRVVVSAPVKEEGVVNIVVGVNDDIFDPAVHQIVTAASCTTNCLAPI 160
113968880 161 VKVIHEQIGIRHGSMTTIHDITNTQTILDAPHKDLRRARACGLSLIPTTTGSATAITHIFPELKGKLNGHAVRVPLANAS 240
218710930 161 VKVINEKLGIENAAFTTIHDLTNTQTILDAPHKDLRRARACGMSLIPTTTGSAKAIVEIFPELENRINGHAVRVPLANAS 240
156972644 161 VKVIHEKLGIEQSSFTTIHDLTNTQMILDAPHKDLRRARACGMSLIPTTTGSATAIVEIFPDLKDKINGHAVRVPLANAS 240
28899744  161 VKVIHEKLGIEQSSFTTIHDLTNTQTILDAPHKDLRRARACGMSLIPTTTGSATAIVEIFPDLKGKINGHAVRVPLANAS 240
37678284  161 VKVIHEKLGIEQASFTTIHDLTNTQTILDAPHKDLRRARACGMSLIPTTTGSATAIVEIFPELKDRINGHAVRVPLANAS 240
27364560  161 VKVIHEKLGIEQASFTTIHDLTNTQTILDAPHKDLRRARACGMSLIPTTTGSATAIVEIFPELKDRINGHAVRVPLANAS 240
262392900 161 VKVIHEKLGIEQSSFTTIHDLTNTQTILDAPHKDLRRARACGMSLIPTTTGSATAIVEIFPDLKGKINGHAVRVPLANAS 240
120556542 162 VKVIREKLGIKHGSLTTIHSLTNTQTIIDAPHKDLRRARACGSSLIPTSTGSATAIIEIFPELKGKLDGHAVRIPLINAS 241
209696222 161 VKVINNEFGIENAAFTTIHDLTNTQTILDAPHKDLRRARACGMSLIPTTTGSAKAIVEIFPELENKINGHAVRVPLANAS 240
59712967  161 VKVINKGLGIENAAFTTIHDLTNTQTILDAPHKDLRRARACGMSLIPTTTGSAKAIVEIFPELKDKIDGHAVRVPLANAS 240
113968880 241 LTDCVFELERRVTEAEVNALLQSAAEGELKGILGYEERPLVSVDYKTDPRSSIVDALSTMVVNGTQLKLYVWYDNEWGYA 320
218710930 241 LTDIIFEVKQDTTAEEVNAMLKEASENELKGILGFEERPLVSIDYKGDQRSTIVDALSTMLVGKRMVKIYAWYDNEMGYA 320
156972644 241 LTDIIFDVKRDTTAEEVNALLKEASEGELKGILGFEERPLVSIDYKGDQRSTIVDAQSTMVVGSRMVKIYAWYDNEMGYA 320
28899744  241 LTDIIFDVKRDTTAEEVNALLKEASDGELKGILGFEERPLVSIDYKGDQRSTIVDALSTMVVGSRMVKIYAWYDNEMGYA 320
37678284  241 LTDIIFDVKRDTTAEEVNALLKEASQGELNGILGFEERPLVSIDYRGDQRSTIVDALSTMVVGTRMVKIYAWYDNEMGYA 320
27364560  241 LTDIIFDVKRDTTAEEVNALLKEASQGELNGILGFEERPLVSIDYRGDQRSTIVDALSTMVVGTRMVKIYAWYDNEMGYA 320
262392900 241 LTDIIFDVKRDTTAEEVNALLKEASEGELKGILGFEERPLVSIDYKGDQRSTIIDAQSTMVVGSRMVKIYAWYDNEMGYA 320
120556542 242 LTDCVFEVETPTDRDTVNQLLKEAAEGQLKDILGYEERPLVSIDYKTDPRSSIVDALSTLVVNGTHVKIYAWYDNEWGYA 321
209696222 241 LTDIVFEVKRDTTVEEVNQLLKEAAYGDLKGILGYEDRPLVSIDYKGDQRSTIVDALSTMLVGKRMVKIYAWYDNEMGYA 320
59712967  241 LTDIIFEVKRDTTVEEVNQLLKDAAQGDLKGILGYEERPLVSIDYKGDQRSTIVDAPSTMLVGKRMVKIYAWYDNEMGYA 320
113968880 321 NRTAELARLVGQL 333
218710930 321 TRTAELVRTVGLA 333
156972644 321 TRTAELVRNVGMA 333
28899744  321 TRTAELVRNVGLA 333
37678284  321 TRTAELVRKVGAA 333
27364560  321 TRTAELVRKVGAA 333
262392900 321 TRTAELVRNVGLA 333
120556542 322 NRTVELARKVGQA 334
209696222 321 TRTAELVRTVGLA 333
59712967  321 TRTAELVRNVGLA 333
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap