Conserved Protein Domain Family
PRK08745

?
PRK08745: PRK08745 
ribulose-phosphate 3-epimerase; Provisional
Statistics
?
PSSM-Id: 136958
View PSSM: PRK08745
Aligned: 14 rows
Threshold Bit Score: 411.33
Threshold Setting Gi: 190576139
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
194367497   1 MSNCLIAPSILSANFARLGEEVDNVLAAGADWVHFDVMDNHYVPNLTIGPMVCQALRKHGVTAPIDVHLMVEPVDRIIPD 80 
188989887  11 MQPTAIAPSILSADFARLGEEVDNVLKAGADWVHFDVMDNHYVPNLTIGPMVCQALRKHGITAPIDVHLMVEPVDRLVPD 90 
122879317   1 MQPTAIAPSILSADFARLGEEVNNVLKAGADWVHFDVMDNHYVPNLTIGSMVCQALRKHGITAPIDVHLMVEPVDRIVPD 80 
84625484   11 MQPTAIAPSILSADFARLGEEVNNVLKAGADWVHFDVMDNHYVPNLTIGSMVCQALRKHGITAPIDVHLMVEPVDRIVPD 90 
188575055  47 MQPTAIAPSILSADFARLGEEVNNVLKAGADWVHFDVMDNHYVPNLTIGSMVCQALRKHGITAPIDVHLMVEPVDRIVPD 126
21241246    1 MQPTAIAPSILSADFARLGEEVNNVLKAGADWVHFDVMDNHYVPNLTIGPMVCQALRKHGITAPIDVHLMVEPVDRIVPD 80 
162138543   1 MQPTAIAPSILSADFARLGEEVNNVLKAGADWVHFDVMDNHYVPNLTIGPMVCQALRKHGITAPIDVHLMVEPVDRIVPD 80 
77747495    1 MSNCLIAPSILSADFARLGAEVDAVLAAGADWIHFDVMDNHYVPNLTFGPMVCKALRSYGITAPIDVHLMVEPVDRIVPD 80 
28198099    1 MSNCLIAPSILSADFARLGAEVDAVLAAGADWIHFDVMDNHYVPNLTFGPMVCKALRSYGITAPIDVHLMVEPVDRIVPD 80 
182680727   1 MSNCLIAPSILSADFARLGAEVDAVLAAGADWIHFDVMDNHYVPNLTFGPMVCKALRSYGITAPIDVHLMVEPVDRIVPD 80 
194367497  81 FAEAGATYISFHPEASRHVHRTIQLIRSLGCKPGIVLNPATPVDILDWVLDDLDLVLLMSVNPGFGGQAFIPSALDKLRV 160
188989887  91 FADAGATTISFHPEASRHVHRTIQLIRSHGCQAGLVLNPATPVDILDWVLPELDLVLVMSVNPGFGGQAFIPSALDKLRA 170
122879317  81 FADAGATTISFHPEASRHVHRTIQLIKSHGCQAGLVLNPATPVDILDWVLPELDLVLVMSVNPGFGGQAFIPSALDKLRA 160
84625484   91 FADAGATTISFHPEASRHVHRTIQLIKSHGCQAGLVLNPATPVDILDWVLPELDLVLVMSVNPGFGGQAFIPSALDKLRA 170
188575055 127 FADAGATTISFHPEASRHVHRTIQLIKSHGCQAGLVLNPATPVDILDWVLPELDLVLVMSVNPGFGGQAFIPSALDKLRA 206
21241246   81 FANAGATTISFHPEASRHVHRTIQLIKSHGCQAGLVLNPATPVDILDWVLPELDLVLVMSVNPGFGGQAFIPSALDKLRA 160
162138543  81 FADAGATTISFHPEASRHVHRTIQLIKSHGCQAGLVLNPATPVDILDWVLPELDLVLVMSVNPGFGGQAFIPSALDKLRA 160
77747495   81 FTQAGASMISFHMEASRHVHRTIQLIKSHGCMAGLVFNPATPVDMLDWVLPELDLVLLMSVNPGFGGQRFIPGTLDKLRL 160
28198099   81 FAQAGASMISFHMEASRHVHRTIQLIKSHGCMAGLVFNPATPVDMLDWVLPELDLVLLMSVNPGFGGQRFIPGTLDKLRL 160
182680727  81 FAQAGASMISFHMEASRHVHRTIQLIKSHGCMAGLVFNPATPVDMLDWVLPELDLVLLMSVNPGFGGQRFIPGTLDKLRL 160
194367497 161 VRKKIDASGRDIRLEIDGGVKADNIGEIAAAGADTFVAGSAIFNAKtSYQDVIAQMRANVAAAR 224
188989887 171 IRSKIDALGKPIRLEIDGGVKADNIGAIAAAGADTFVAGSAIFNAP-DYAQIIAQMRAAVDAAR 233
122879317 161 IRTKIDALGKPIRLEIDGGVKADNIGAIAAAGADTFVAGSAIFNAP-DYAQVIAQMRAAVEAVR 223
84625484  171 IRTKIDALGKPIRLEIDGGVKADNIGAIAAAGADTFVAGSAIFNAP-DYAQVIAQMRAAVEAVR 233
188575055 207 IRTKIDALGKPIRLEIDGGVKADNIGAIAAAGADTFVAGSAIFNAP-DYAQVIVQMRAAVEAVR 269
21241246  161 IRSKIDATGKPIRLEIDGGVKADNIGAIAAAGADTFVAGSAIFNAP-DYAQVIAQMRAAVDAVR 223
162138543 161 IRRKIDATGKPIRLEIDGGVKADNIGAIAAAGADTFVAGSAIFNAP-DYAQVIAQMRAAVDAVR 223
77747495  161 VRKKIDLLGRPVRLEVDGGVGIDNIGAIAEAGADTFVAGSAIFHAP-DYGDVIAHMRAAVAAVR 223
28198099  161 VRKKIDLLGRPVRLQVDGGVGIDNIGAIAEAGADTFVAGSAIFHAR-DYADVVAQMRAAVAAVR 223
182680727 161 VRKKIDLLGRPVRLQVDGGVGIDNIGAIAEAGADTFVAGSAIFHAR-DYADVVAQMRAAVAAVR 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap