Conserved Protein Domain Family
PRK08706

?
PRK08706: PRK08706 
lipid A biosynthesis lauroyl acyltransferase; Provisional
Statistics
?
PSSM-Id: 169557
View PSSM: PRK08706
Aligned: 9 rows
Threshold Bit Score: 536.372
Threshold Setting Gi: 15677277
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
59800612    1 MKFIFFVLYVLQFLPFALLHKIAGLIGSLAYLLVKPRRRIGEINLAKCFPEWDEEKRKTVLKQHFKHMAKLMLEYGLYWY 80 
194097788  11 MKFIFFVLYVLQFLPFALLHKIAGLIGSLAYLLVKPRRRIGEINLAKCFPEWDEEKRKTVLKQHFKHMAKLMLEYGLYWY 90 
254805200   5 MKFIFFVLYVLQFLPFALLHKIADLTGLLAYLLVKPRRRIGEINLAKCFSEWSEEKRKTVLKQHFKHMAKLMLEYGLYWY 84 
15677277    1 MKFIFFVLYVLQFLPFALLHKIADLTGLLAYLLVKPRRRIGEINLAKCFSEWSEEKRKTVLKQHFKHMAKLMLEYGLYWY 80 
218768422   1 MKFIFFVLYVLQFLPFALLHKLADLTGLLAYLLVKPRRRIGEINLAKCFPEWDGKKRKTVLKQHFKHMAKLMLEYGLYWY 80 
121635108   1 MKFIFFVLYVLQFLPFALLHKLADLTGLLAYLLVKPRRRIGEINLAKCFPEWDGKKRETVLKQHFKHMAKLMLEYGLYWY 80 
161870283  11 MKFIFFVLYVLQFLPFALLHKIADLTGLLAYLLVKPRRRIGEINLAKCFPEWSEEKRKTVLKQHFKHMAKLMLEYGLYWY 90 
34496416    1 MKFAFALLWLIRLLPMRVIGLLAAGLGNLAYLLARGRRRVGLINLRLCFPDMPMAERKRLIRKNCQHMIRMVLEYGVCWW 80 
226939510   1 MRLALFVLWLLHFLPLSAIDRLARPVGWLAYHLVKPRRRVGERNLAACFPDWTPAARDRLLRDHFHAMARLLLEYGVVWY 80 
59800612   81 ASAKCLKSLVRYRNKHYLDDALAAGEKVIILYPHFTAFEMAVYALNQDVPLISMYSHQKNKILDEQILKGRNRYHNVFLI 160
194097788  91 APAKCLKSLVRYRNKHYLDDALAAGEKVIILYPHFTAFEMAVYALNQDVPLISMYSHQKNKILDEQILKGRNRYHNVFLI 170
254805200  85 APAGRLKSLVRYRNKHYLDDALAAGEKVIILYPHFTAFEMAVYALNQDIPLISMYSHQKNKILDEQILKGRNRYHNVFLI 164
15677277   81 APAGRLKSLVRYRNKHYLDDALAAGEKVIILYPHFTAFEMAVYALNQDIPLISMYSHQKNKILDEQILKGRNRYHNVFLI 160
218768422  81 APAGRLKSLVRYRNKHYLDDALAAGEKVIILYPHFTAFEMAVYALNQDVPLISMYSHQKNKILDEQILKGRNRYHNVFLI 160
121635108  81 APAGRLKSLVRYRNKHYLDDALAAGEKVIILYPHFTAFEMAVYALNQDVPLISMYSHQKNKILDAQILKGRNRYDNVFLI 160
161870283  91 APAGRLKSLVRYRNKHYLDDALAVGEKVIILYPHFTAFEMAVYALNQDVPLISMYSHQKNKILDEQILKGRNRYHNVFLI 170
34496416   81 SSAKRIDGLVEIKNLHYVTDLRDKGEDVILFYPHFVGFEMCVYALNQYIPLVSVYSHQKNEALDKQIYAGRQRYDNAYIV 160
226939510  81 SPDARFRDLVRYKNLHYLTDL--RDENVIILYPHFVGFEMCVFRLNQDVPLVSVYSNQKNELLDRKIYEGRQRYGNCKII 158
59800612  161 GRTEGLRALVKQFRKSSAPFLYLPDQDFGRNNSVFVDFFGIQTATITGLSRIAALANAKVIPAIPVREADNTVTLQFYPA 240
194097788 171 GRTEGLRALVKQFRKSSAPFLYLPDQDFGRNNSVFVDFFGIQTATITGLSRIAALANAKVIPAIPVREADNTVTLQFYPA 250
254805200 165 GRTEGLRALVKQFRKSSAPFLYLPDQDFGRNDSVFVDFFGIQTATITGLSRIAALANAKVIPAIPIREADNTVTLHFYPA 244
15677277  161 GRTEGLRALVKQFRKSSAPFLYLPDQDFGRNDSVFVDFFGIQTATITGLSRIAALANAKVIPAIPVREADNTVTLHFYPA 240
218768422 161 GRTEGLRALVKQFRKSSAPFLYLPDQDFGRNDSVFVDFFGIRTATITGLSRIAALANAKVIPAIPVREADNTVTLHFYPA 240
121635108 161 GRTEGLRALVKQFRKSSAPFLYLPDQDFGRNDSVFVDFFGIQTATITGLSRIAALANAKVIPAIPVREADNTVTLHFYPA 240
161870283 171 GRTEGLRALVKQFRKSSAPFLYLPDQDFGRNDSVFVDFFGIQTATITGLSRIAALANAKVIPAIPVREADNTVTLHFYPA 250
34496416  161 SRQEGLRPIIKAMRKDHAPFLYLPDQDFGVRDSLFVDFFGVKAATITGMSRIAKLARAKVVPAIARRVGD-RFELEFYPP 239
226939510 159 SRREGLRSIIKAM-KDHTPFLYLPDQDFGARDSVFVPFFGVPTATIAGMSRIARLTRARVVPVIPRRISAAQYELECFPA 237
59800612  241 WKSFPSEDAQADAQRMNRFIEERVREHPEQYFWLHKRFKTRPEGSPDFY 289
194097788 251 WKSFPSEDAQADAQRMNRFIEERVREHPEQYFWLHKRFKTRPEGSPDFY 299
254805200 245 WESFPGEDAQADAQRMNRFIEERVREHPEQYFWLHKRFKTRPEGSPDFY 293
15677277  241 WKSFPGEDAKADAQRMNRFIEDRVREHPEQYFWLHKRFKTRPEGSPDFY 289
218768422 241 WESFPSEDAQADAQRMNRFIEERVREHPEQYFWLHKRFKTRPEGSPDFY 289
121635108 241 WESFPSEDAQADAQRMNRFIEERVREHPEQYFWLHKRFKTRPEGSPDFY 289
161870283 251 WKSFPSEDAQADAQRMNRFIEERVREHPEQYFWLHKRFKTRPEGSPDFY 299
34496416  240 WDGYPSEDIEADTRRMNAFLEDRVREIPDQYFWLHKRFKNRPQGETRVY 288
226939510 238 WDDFPSGDETEDARRMNAFIEERVREQPEQYFWLHKRFKTRPEGEPPFY 286
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap