Conserved Protein Domain Family
PRK08703

?
PRK08703: PRK08703 
SDR family oxidoreductase
Statistics
?
PSSM-Id: 169556
View PSSM: PRK08703
Aligned: 10 rows
Threshold Bit Score: 457.471
Threshold Setting Gi: 121634868
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
59801242    1 MPTLTDKTILVTGASQGLGEQVAKAYAAEGATVILVARHQKKLEKAYDAIVEAGHPEPFAIRFDLMSAEEKEFERFAATI 80 
194098539   1 MPTLTDKTILVTGASQGLGEQVAKAYAAEGATVILVARHQKKLEKAYDAIVEAGHPEPFAIRFDLMSAEEKEFERFAATI 80 
254804958   1 MATLTDKTILVTGASQGLGEQVAKAYAAAGATVILVARHQKKLEKVYDAIVEAGHPEPFAIRFDLMSAEEKEFNQFAATI 80 
15677004    1 MATLSDKTILVTGASQGLGEQVAKAYAAAGATVILVARHQKKLEKVYDAIVEAGYPEPFAICFDLISAEEKEFEHFAATI 80 
15677040    1 MATLSDKTILVTGASQGLGEQVAKAYAAAGATVILVARHQKKLEKVYDAIVEAGYPEPFAICFDLISAEEKEFEHFAATI 80 
218768183  18 MATLSDKTILITGASQGLGEQVAKAYAAAGATVILVARHQKKLEKVYDAIVEARHPEPFAIRFDLMSAEEKEFNQFAATI 97 
121634868   1 MATLSDKTILVTGASQGLGEQVAKAYAAAGATVILVARHQKKLEKVYDAIVEAGYPEPFAICFDLISAEEKEFEHFAATI 80 
161870014   1 MATLSDKTILITGASQGLGEQVAKAYAAAGATVILVARHQKKLEKVYDAIVEAGHPEPFAIRFDLMSAEEKEFNQFAATI 80 
34498431    9 QDALAGRVILITGASQGIGREAALTFARHGATVVLLSRSVKGLEKVYDEIVAAGGPEPAAVPLDLLNAGENEFNQLALTI 88 
226940960   8 PKPLQDRVILVTGSSQGIGKAVALDLALHGATVVLLSRNARRLEAVYDEIVAAGGPEPAAIPMDLLETSDEQFEQLALQI 87 
59801242   81 AEATQGKLDGIVHCAGYFYALSPLDFQTVAEWVNQYRINTVAPMGLTRALFPLLKQSPDASVIFVGESHGETPKAYWGGF 160
194098539  81 AEATQGKLDGIVHCAGYFYALSPLDFQTVAEWVNQYRINTVAPMGLTRALFPLLKQSPDASVIFVGESHGETPKAYWGGF 160
254804958  81 AEATQGKLDGIVHCAGYFYALSPLDFQTVAEWVNQYRINTVAPMGLTRALFPLLKQSPDASVIFVGESHGETPKAYWGGF 160
15677004   81 AEATQGKLDGIVHCAGYFYALSPLDFQTVAEWVNQYRINTVAPMGLTRALFPLLKQSPDASVIFVGESHGETPKAYWGGF 160
15677040   81 AEATQGKLDGIVHCAGYFYALSPLDFQTVAEWVNQYRINTVAPMGLTRALFPLLKQSPDASVIFVGESHGETPKAYWGGF 160
218768183  98 AEATQGKLDGIVHCAGYFYALSPLDFQTVAEWVNQYRINTVAPMGLTRALFPLLKQSPDASVIFVGESHGETPKAYWGGF 177
121634868  81 AEATQGKLDGIVHCAGYFYALSPLDFQTVAEWVNQYRINTVAPMGLTRALFPLLKQSPDASVIFVGESHGETPKAYWGGF 160
161870014  81 AEATQGKLDGIVHCAGYFYALSPLDFQTVAEWVNQYRINTVAPMGLTRALFPLLKQSPDASVIFVGESHGETPKAYWGGF 160
34498431   89 QREF-GRLDGIAHCASHFYALSPLTNQTIEEWMNQYRINTVAPFALTRACLPLLKEAPDASVLFVGEHHALHPAAYWGGF 167
226940960  88 YKEL-GRLDGIVHCAAHLYALSPLRDQRIEEWMNQFRINTVAPFALTRACLPLLARSPDASVVFVGETHGLKASPYWGAF 166
59801242  161 GASKAALNYLCKVAADEWERFGNLRANVLVPGPINSPQRIKSHPGEAGSERKSYGDVLPAFVWWASAESKGRSGEIVYL 239
194098539 161 GASKAALNYLCKVAADEWERFGNLRANVLVPGPINSPQRIKSHPGEARSERKSYGDVLPAFVWWASAESKGRSGEIVYL 239
254804958 161 GASKAALNYLCKVAADEWERFGNLRANVLVPGPINSPQRIKSHPGEAKSERKSYGDVLPAFVWWASAESKGRSGEIVYL 239
15677004  161 GASKAALNYLCKVAADEWERFGNLRANVLVPGPINSPQRIKSHPGEAKSERKSYGDVLPAFVWWASAESKGRSGEIVYL 239
15677040  161 GASKAALNYLCKVAADEWERFGNLRANVLVPGPINSPQRIKSHPGEAKSERKSYGDVLPAFVWWASAESKGRSGEIVYL 239
218768183 178 GASKAALNYLCKVAADEWERFGNLRANVLVPGPINSPQRIKSHPGEAKSERKSYGDVLPAFVWWASTESKGRSGEIVYL 256
121634868 161 GASKAALNYLCKVAADEWERFGNLRANVLVPGPINSPQRIKSHPGEAKSERKSYGDVLPAFVWWASTESKGRSGEIVYL 239
161870014 161 GASKAALNYLCKVAADEWEHFGNLRANVLVPGPINSPQRIKSHPGEAKSERKSYGDVLPAFVWWASAESKGRSGEIVYL 239
34498431  168 GASNAGLPYLTKVAADEWEMLPSLRVNLLLPGPVNSPQRNRTHPGEDKSERADLADLMPHFLYWLGADSRGRSGEVVEL 246
226940960 167 SVSKAGLSHLTQIAASEWDCYPNLRVNLLVPGPVHSPQRTRTHPGVAKTELPSIDTLLPAFRYWAGPESAGRSGEIVEL 245
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap