Conserved Protein Domain Family
PRK08690

?
PRK08690: PRK08690 
enoyl-[acyl-carrier-protein] reductase FabI
Statistics
?
PSSM-Id: 169553
View PSSM: PRK08690
Aligned: 9 rows
Threshold Bit Score: 518.755
Threshold Setting Gi: 226940772
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
226940772   1 MGFLQGKKILITGLLSNRSIAYGIAEACKNQGAELAFTYVNEKLKDRVVEMATkDFGSNIVLKCDVSSDEDIDNLFAELG 80 
59801991    1 MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAA-ELDSELVFRCDVASDDEINQVFADLG 79 
194099548   1 MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAA-ELDSELVFRCDVASDDEINQVFADLG 79 
254805629   1 MGFLQGKKILITGMISERSIAYGIAKACREQGADLAFTYVVDKLEERVRKMAA-ELDSELVFRCDVASDDEINQVFADLG 79 
15676251    1 MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAA-ELDSELVFRCDVASDDEINQVFADLG 79 
218768888   1 MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAA-ELGSELVFRCDVASDDEINQVFADLG 79 
121635528   1 MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAA-ELDSELVFRCDVASDDEINQVFADLG 79 
161870734   1 MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAA-ELDSELVFRCDVASDDEINQVFADLG 79 
34497038    1 MGFLQGKKILITGMISNRSIAYGIAQACHREGAELAFTYVVDKLEERVREMAA-DFGSQLVYRCDVQNDDEINQLFVDLA 79 
226940772  81 QHWDGLDGLVHAIAFAPREALAGDFLDNLSREAFQVSHDISAYSFPALAKAARPMMQGRRGALLTLSYLGAVRAIPHYNV 160
59801991   80 KHWDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEISAYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNV 159
194099548  80 KHWDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEISAYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNV 159
254805629  80 KHWDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEISAYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNV 159
15676251   80 KHWDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEISAYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNV 159
218768888  80 KHWDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEISAYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNV 159
121635528  80 KHWDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEISAYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNV 159
161870734  80 KHWDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEISAYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNV 159
34497038   80 KEWDGLDGLVHSIGFAPREALEGDFLDSLSREAFQIAHDVSSYSFPALAKAARPMMQGRKAALLTLSYLGAVRAIPNYNV 159
226940772 161 MGLAKASLEASVRFTAASVGREGTRCNGISAGPIKTLAASGISGFGKLLKMASDNAPLKRNVTIEEVGNAAAFLLSDLAS 240
59801991  160 MGMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSS 239
194099548 160 MGMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSS 239
254805629 160 MGMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSS 239
15676251  160 MGMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSS 239
218768888 160 MGMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSS 239
121635528 160 MGMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSS 239
161870734 160 MGMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSS 239
34497038  160 MGLAKASLEASVRFMAASLGKEGIRVNGISAGPIKTLAASGISGFSKLLNMASSQACLRRNVTTEEVGNAAAFMLSDLSS 239
226940772 241 GITGEITYVDAGYNINALNVPD 262
59801991  240 GITGEITYVDGGYSINALSTEG 261
194099548 240 GITGEITYVDGGYSINALSTEG 261
254805629 240 GITGEITYVDGGYSINALSTEG 261
15676251  240 GITGEITYVDGGYSINALSTEG 261
218768888 240 GITGEITYVDGGYSINALSTEG 261
121635528 240 GITGEITYVDGGYSINALSTEG 261
161870734 240 GITGEITYVDGGYSINALSTEG 261
34497038  240 GITGEITYVDAGYSVNALNVPE 261
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap