Conserved Protein Domain Family
PRK08666

?
PRK08666: PRK08666 
5'-methylthioadenosine phosphorylase; Validated
Statistics
?
PSSM-Id: 169548
View PSSM: PRK08666
Aligned: 14 rows
Threshold Bit Score: 499.235
Threshold Setting Gi: 114566316
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242399395  13 MPRIAIIGGSGVYDPRLLENLREEMIKTPYGNIKVKIGTYKGEEIAFLARHGEKHSVPPHKINYRANIWGLHELGVERIL 92 
114566316   1 MVKTAIIGGTGVYDPCLLEDVREIVETTPYGSVKVSLGKYAGMEVAFIPRHGLEHSIPPHLINYRANIKALQQLGIKNIL 80 
258514471   2 TVKIAIIGGTGVYDPNILENIHEEQLETEYGRTLVKIGEYKGKKVAFMARHGADHSVPPHLVNYRANIAGLKQLGVKNIF 81 
134299911   2 SVRIAIIGGTGVYDPNILDNIRDEKVSTAYGEVGMKIGDYQGKSVAFLNRHGVGHSVPPHLVNYRANIAALKELGVKSIF 81 
18977225    1 MPRIAIVGGSGVYDFPA-ENKREETVKTPYGEVKITVGVVGDEEVAFLARHGKGHSIPPHKINYRANIWALYELGVERII 79 
14521279    1 MVRVAVIGGSGVYDFPA-ENKRSVTVETPYGKVEVTIGLVNGEEVAFLARHGKGHSIPPHKINYRANIWALYELGVERII 79 
14590971    1 MVRVAVIGGSGVYDFPA-ENKRELTVETPYGKVNLTIGHVAGEEVAFLARHGKGHSVPPHKVNYRANIWALHELGVERIV 79 
212223274   1 MPRIAIIGGSGVYDPKLLQNVREEWVSTPYGKVRVKIGEYNGEEIAFLARHGEGHSVPPHKINYRANIWALHELGVERIL 80 
51892834    5 KVRLAIIGGTGVYDPRILENIREEVITTPYGQAKVRIGTYAGEEVAFMARHGVDHSVPPHLINYRANIYALKMLGVERVI 84 
83589557    1 -MRIAIIGGSGVYDPGILTNIHEERVETPYGAAVLKVGTYHGEEIGFMPRHGDKHTVPPHKVNYRANIWALKMLKVERVL 79 
242399395  93 ATSAVGSVNEAMKPGDFVILDQLIDFTKNRTYTFYDGEDAPhernfVAHVDFTDPYCPELRDSLIRAARELGFSYHPRGT 172
114566316  81 ATAAVGSLHFEFKPGQFVLADQFLDFTKNRGSTFYEGGEAG-----VVHCDMTVPYCPELREALVKAGRELEIQVQNGGT 155
258514471  82 ATAAVGSLNQSMKAEDFVFVDQFLDFTKVRKHTFFEGGENG-----VVHLDVTDPYCPELRRLLMEVSGNLGLTAHNGGT 156
134299911  82 ATAAVGSLNRNMAPGHFVFSDQFLDFTKVRKNTFFEGGEQG-----VVHIDMTDPYCPELRKVLTSAAEDLGLTYHRYGT 156
18977225   80 ATSAVGSMNPEMKPGDFVILDQIIDFTVSRPRTFYDGEESPherkfVAHVDFTEPYCPEIRKALITAARNLGLPYHPRGT 159
14521279   80 ATSAVGSMNPNMRPGDFVILDQIIDFTVSRPRTFYDGEESPhdrkfVAHVDFTEPYCPEIRRALIAAAKELSLPYHPRGT 159
14590971   80 ATSAVGSLNPNMRPGDFVILDQLIDFTVSRPRTFYDGEESPhdrkfVAHVDFTEPYCPEIRRALITAAKDLSLPYHPKGT 159
212223274  81 STSAVGSLNETMKPGDFVILDQLMDFTKTRHYTFYDGDESPhdrkfVAHVDFTDPYCPELRKALITAARELGFKYHPTGT 160
51892834   85 ATTAVGSCNRNMKPGDFVVVDQFLDFTKGRVSTFFEGGEAG-----VVHTDVTEPYCPELRKVLIAAAQEVGVHAHPTGT 159
83589557   80 ATAAVGSTNPEFRPGDFVIVNDFLDFTKTRTYTFFEGGETG-----VVHTDFTTPYCPELGQVLVETAARLGIKAHAGGV 154
242399395 173 YAAMEGPRFETRAEIRALRILGADVVGMTQSPEAILARELEMCYASVAIVTNYGAGISKTKLTHSEVVELMQQKSEEIKL 252
114566316 156 YVCTEGPRFETAAEIMMFKQLGGQLVGMTSVPEVCLARELGICYATVAIVTNFAAGITTGILTHSEVLELMKRNIELARS 235
258514471 157 YVCTEGPRFETPAEIRMFARLGGDLVGMTSVPEVVLAREVQMCYATICMVTNYAAGIAEYKLSHQEVVEVMSKNVANLRR 236
134299911 157 YVTCEGPRFETPAEIKMYQLLGGDLVGMTSVPEVVLAREKEMCYANISMVTNYAAGISPTKLTHQEVLDVMAENAGNLKK 236
18977225  160 YVCTEGPRFETAAEIRAYRILGGDVVGMTQCPEAILARELEMCYATVAIVTNYAAGMSGKKLTHSEVVELMQKKSEDIVK 239
14521279  160 YVCTEGPRFETAAEIKAYRILGGDVVGMTQCPEAILARELEICYATVAIVTNYAAGISGKKLTHSEVVELMNKKSKEIVA 239
14590971  160 YVCTEGPRFETAAEIRAYRILGGDVVGMTQCPEAALARELEMCYATVAIVTNYAAGISGKKLTHAEVVELMNKKTREITA 239
212223274 161 YACMEGPRFETRAEIRALKILGADVVGMTQCPEAALARELEMCYASVAIVTNFAAGISREKLTHTEVVELMAQKSEEIKY 240
51892834  160 YVCTEGPRFETAAEIRMYGQLGGDLVGMTNVPECVLAREAGICYATVSMVTNFGAGISPNPLTHEEVLEVMAANGENLKK 239
83589557  155 YACTEGPRFETPAEIRMIRQLGGDLVGMTNVPEVVLAHEVGLCYGLIAMVTNMAAGISSTPLSHEEVLEIMDQNGKNLRD 234
242399395 253 LLMKAVEHIPRIRRCACKDALKGATG 278
114566316 236 LMMSSLKYITEEKRCNCRKILDEPGA 261
258514471 237 LIMETIESLEEGRTCSCQISHVDPV- 261
134299911 237 LAMKAISLIDPERGCLCQEALERLNK 262
18977225  240 LILAAIPLIPKERRCGCKDALKGATG 265
14521279  240 LITKAIPLIPKERNCPCKDALKGATG 265
14590971  240 LITKAIPLIPKERNCPCKDALKGATG 265
212223274 241 LLMKSIKYIPEERRCGCKDALKGATG 266
51892834  240 LLFAALRQIPAGRGCACGSNTALKV- 264
83589557  235 LIMQAIPGIPRQRNCRCSLAAGKIEV 260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap