Conserved Protein Domain Family
PRK08463

?
PRK08463: PRK08463 
acetyl-CoA carboxylase subunit A; Validated
Statistics
?
PSSM-Id: 169452
View PSSM: PRK08463
Aligned: 12 rows
Threshold Bit Score: 868.746
Threshold Setting Gi: 34557652
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154148914   1 MIHKILIANRGEIAVRVIRACRDLHLKSVAIYTKPDADCLHVKIADEAYEVGAEPLKGYLDPKIIVETAKKCGADAIHPG 80 
218562653   3 QIHKILIANRAEIAVRVIRACRDLHIKSVAVFTEPDRECLHVKIADEAYRIGTDAIRGYLDVARIVEIAKACGADAIHPG 82 
121613650   3 QIHKILIANRAEIAVRVIRACRDLHIKSVAVFTEPDRECLHVKIADEAYRIGTDAIRGYLDVARIVEIAKACGADAIHPG 82 
157415294   3 QIHKILIANRAEIAVRVIRACRDLHIKSVAVFTEPDRECLHVKIADEAYRIGTDAIRGYLDVARIVEIAKACGADAIHPG 82 
34557652    1 MFKKILIANRGEIAVRIIRACNDLNIESVAIYSRADRDSMHVKMADETHEISEDPIKGYLDPDRIIEVAKLSGAEAIHPG 80 
153951249   3 QIHKILIANRAEIAVRVIRACRDLHIKSVAVFTEPDRECLHVKIADEAYRIGTDAIRGYLDVVRIVEIAKACGADAIHPG 82 
222823597   1 MIHKILIANRGEIAVRVIRACRDLHIKSVAVYTEPDYECLHVKVADEAYRIGTDAIRGYLDGKRIVEIAKACGADAIHPG 80 
57237923    3 QIHKILIANRAEIAVRVIRACRDLHIKSVAVFTEPDRECLHVKIADEAYRIGTDAIRGYLDVARIVEIAKACGADAIHPG 82 
154174589   1 MIHKILIANRGEIAVRIVRACRDLHMQSVAIYTAPDAQCLHVRIADEAHMVGDDPIKGYLDAKAIVKLAKECGADAIHPG 80 
32267348    1 MFQKILIANRGEIAVRIIRACRDLHIKSIAIYARADRDCLHVKMADESYEISDDPLQGYLDADLIIEVALRAEADAIHPG 80 
157165069   1 MIHKILIANRGEIAVRIVRACRDLHIQSVGIYTAPDSECLHVRIADEAYQVGEDPIKGYLDAKAIVKLAKECGADAIHPG 80 
118475185   1 MIHKILIANRGEIAVRIVRACKDLHIKNVAIYTEPDRECLHVKVADEAYQIGKDPIKGYLDSKRIVEVAKACGADAIHPG 80 
154148914  81 YGFLSENYDFAKEVEDAGLTFIGPRPDVIRKMGNKNIARYLMRKNGIPIVPGTEKLNNETMDKIKEYARKIGYPVILKAS 160
218562653  83 YGFLSENYEFAKACEDAGIIFIGPKSEVIHKMGNKNIARKLMAKNGIPIVPGTEKLNSYSMEEIKIFAEKIGYPVILKAS 162
121613650  83 YGFLSENYEFAKACEDAGIIFIGPKSEVIHKMGNKNIARKLMAKNGIPIVPGTEKLNSYSMEEIKIFAEKIGYPVILKAS 162
157415294  83 YGFLSENYEFAKACEDAGIIFIGPKSEVIHKMGNKNIARKLMAKNGIPIVPGTEKLNSYSMEEIKIFAEKIGYPVILKAS 162
34557652   81 YGFLSENALFAKKVAEAGLVWIGPNSEVIAKMGDKNAAREIMQRHGIPVVPGTEPLNKESMESIKRHARRIGYPVILKAS 160
153951249  83 YGFLSENYEFAKACEDAGIIFIGPKSEVIYKMGNKNIARKLMAENGIPIVPGTEKLNSYTLKEIKIFAEKIGYPVILKAS 162
222823597  81 YGFLSENYEFAKECEEAGIIFIGPKSDVIRKMGNKNIARYLMKKNGIPVVPGTEKLNHCTLEEIKLQALKIGYPVILKAS 160
57237923   83 YGFLSENYEFAKACEDAGIIFIGPKSEVIHKMGNKNIARKLMAKNGIPIVPGTEKLNSYSMEEIKIFAEKIGYPVILKAS 162
154174589  81 YGFLSENYEFAKMVEDAGLIFIGPKADVIRKMGDKNIARYLMKKNGIPIVPGTEKLNDDSMDTIKEHARRIGYPVILKAS 160
32267348   81 YGFLSENATFAKKVQEAGITWIGPDALTIAKMGDKNAARAIMEKNGIPIVPGTQPLNKHSISDIAKYAQKIGYPVILKAS 160
157165069  81 YGFLSENYEFAKAVEDAGLIFIGPKAEVIKKMGDKNIARYLMKKNGIPIVPGTEKLNDESMDAIKEHARRIGYPVILKAS 160
118475185  81 YGFLSENYEFSKEVEDAGLIFIGPNSDIIRKMGNKNIARFLMKKNGIPVVPGTEKLNSETIEAIKNYAVRIVYPVILKAS 160
154148914 161 GGGGGRGIREVWDEKDMESSFEACKREAKTFFNNDEVFMEKLIVKPRHIEFQILGDNYGNIIHLCERDCSIQRRHQKIIE 240
218562653 163 GGGGGRGIRVVHKEQDLENAFESCKREALTYFNNDEVFMEKYVVNPRHIEFQILGDNYGNIIHLCERDCSIQRRHQKVIE 242
121613650 163 GGGGGRGIRVVHKEQDLENAFESCKREALTYFNNDEVFMEKYVVNPRHIEFQILGDNYGNIIHLCERDCSIQRRHQKVIE 242
157415294 163 GGGGGRGIRVVHKEQDLENAFESCKREALTYFNNDEVFMEKYVVNPRHIEFQILGDNYGNIIHLCERDCSIQRRHQKVIE 242
34557652  161 SGGGGRGIRVVQKEEELEDSFNACKREAMAFFKNDDVFMEKYVQNPKHIEFQILADNYGNVIHLMERDCSIQRRHQKLVE 240
153951249 163 GGGGGRGIRVVHKEQDLENAFESCKREALTYFNNDEVFMEKYVVNPRHIEFQILGDNYGNIIHLCERDCSIQRRHQKMIE 242
222823597 161 GGGGGRGIRVVHKEEDLEKSFEACKREALSFFKNDEVFMEKYVINPRHIEFQILADNYGNIIHLCERDCSIQRRHQKIIE 240
57237923  163 GGGGGRGIRVVHKEQDLENAFESCKREALTYFNNDEVFMEKYVVNPRHIEFQILGDNYGNIIHLCERDCSIQRRHQKVIE 242
154174589 161 GGGGGRGIREVWQEEDMENAFNSCTREAKAYFNNDEVFMEKLVVNPRHIEFQILGDNYGNIIHLCERDCSIQRRHQKIIE 240
32267348  161 SGGGGRGIRVVEKEEDLIESFEACKREAMAFFKNDDVFMEKYIVNPRHIEFQILADNYGNVIHLLERDCSIQRRHQKLVE 240
157165069 161 GGGGGRGIREVWQEEDMQDAFESCTREAKAYFNNDEVFMEKLVVNPRHIEFQILGDNYGNIIHLCERDCSIQRRHQKIIE 240
118475185 161 GGGGGRGIRVVWKEDELESSYESCKREAKAFFNNDEVFMEKYIEKPRHIEFQILGDNYGNLIHLCERDCSIQRRHQKVIE 240
154148914 241 IAPCPSISDNLRKVMGVTAVAAAKAVGYSNAGTVEFLLDDNNDFYFMEMNTRIQVEHGVTEEITGTDLVVRQIRIASGEI 320
218562653 243 IAPCPGISDNLRKTMGVTAVAAAKAVGYTNAGTIEFLLDDYNRFYFMEMNTRIQVEHPITEEITGIDLIVRQIRIAAGEI 322
121613650 243 IAPCPGISDNLRKTMGVTAVAAAKAVGYTNAGTIEFLLDDYNRFYFMEMNTRIQVEHPITEEITGIDLIVRQIRIAAGEI 322
157415294 243 IAPCPGISDNLRKTMGVTAVAAAKAVGYTNAGTIEFLLDDYNRFYFMEMNTRIQVEHPITEEITGIDLIVRQIRIAAGEI 322
34557652  241 IAPSPTMSEDLRRRMGAVAVAAAKATGYSNAGTVEFLVDDYNNFYFMEMNTRIQVEHGVTEEITGLDLIGRQIRIASGEI 320
153951249 243 IAPCPGISDNLRKTMGVTAVAAAKAVGYTNAGTIEFLLDDYNRFYFMEMNTRIQVEHPITEEITGIDLIVRQIRIAAGEI 322
222823597 241 IAPCPSISEKLRKTIGVTAVAAAKAVGYTNVGTVEFLLDDYNRFYFMEMNTRIQVEHPITEEITGIDLITRQIRIANGEI 320
57237923  243 IAPCPGISDNLRKTMGVTAVAAAKAVGYTNAGTIEFLLDDYNRFYFMEMNTRIQVEHPITEEITGIDLIVRQIRIAAGEI 322
154174589 241 IAPCPSISENLRKVMGMTAVAAAKAVGYSNVGTIEFLLDDYNNFYFMEMNTRIQVEHGVTEEITGHDLVVRQIRIAAGEL 320
32267348  241 IAPSPLISDDLRRRMGAAAVAAAKAAQYTNAGTVEFLLDENNTFYFMEMNTRIQVEHGVTEEITGYDLIGRQIRIAQGEI 320
157165069 241 IAPCPSISENLRKIMGVTAVAAAKAVGYSNVGTIEFLLDDYNNFYFMEMNTRIQVEHGITEEITGHDLVVRQIRIAAGEI 320
118475185 241 IAPCPTISEDLRKRMGVAAVAAAKAVGYTNAGTIEFLLDDYNNFYFMEMNTRIQVEHGVTEEITGVDLISRQIRIAAGEI 320
154148914 321 LELEQSDIKPHGFAIEARITAENVWKNFIPTPGTITGYYPALGPSVRVDSHIYKDYKIPPFYDSLLAKLIVKSTGYDLVV 400
218562653 323 LDLEQSDIKPRGFAIEARITAENVWKNFIPSPGKIGEYYPALGPSVRVDSHIYKDYTVPPYYDSMLAKLIIKATSYDLAV 402
121613650 323 LDLEQSDIKPRGFAIEARITAENVWKNFIPSPGKIGEYYPALGPSVRVDSHIYKDYTVPPYYDSMLAKLIIKATSYDLAV 402
157415294 323 LDLEQSDIKPRGFAIEARITAENVWKNFIPSPGKIGEYYPALGPSVRVDSHIYKDYTVPPYYDSMLAKLIIKATSYDLAV 402
34557652  321 LDMNQNDVLCQGFAIEVRINAEDVKNDFVPSPGKITSYYPALGPFVRVDSCIYKDYTIPPYYDSMVAKLIVRATSYDLAV 400
153951249 323 LDLEQSDIKPRGFAIEARITAENVWKNFIPSPGKIGEYYPALGPSVRVDSHIYKDYTVPPYYDSMLAKLIIKATSYDLAV 402
222823597 321 LDLEQSDIKPRGFAIEARITAENVWKNFIPSPGKITEYFPALGPSVRVDSHLYKDYTVPPYYDSLLAKLIVKGSSYDSAV 400
57237923  323 LDLEQSDIKPRGFAIEARITAENVWKNFIPSPGKIGEYYPALGPSVRVDSHIYKDYTVPPYYDSMLAKLIIKATSYDLAV 402
154174589 321 LEIEQSDIKPRGYAIEARITAENVWQNFTPAPGTITGYYPALGPSVRVDSHAYKDYTIPPFFDSLVAKLIVKATDYDLAV 400
32267348  321 LDLTQHDIRAQGFAIEVRINAEDVANDFVPNPGKITTYYPALGPFVRVDSCIYKDYVIPPFYDSMVAKLIVKASSYNLAV 400
157165069 321 LEIEQSDIKPRGYAIEARITAENVWENFIPAPGTIEGYYPALGPSVRVDSHVYKDYTIPPFYDSLIAKLIVKATDYDLAV 400
118475185 321 LDIEQNEVRPQGVSIEARITAENVWKNFAPSPGRITGYFPALGPGVRVDSHMYQDYVIPPFYDSLVAKLIVKGTSYDLAV 400
154148914 401 NKLERALKEFKIEGVQTIIPFLLAISKSREFRRGFFDTSYVESNLQKILDATNDPMnpQKKDDEVVAAVSAVMQMINEKK 480
218562653 403 NKLERALKEFVIDDIRTTIPFLIAITKTREFRRGYLDTSFIETHMQELLEKTEDRH--QENKEEVIAAIAATLKKIRESR 480
121613650 403 NKLERALKEFVIDDIRTTIPFLIAITKTREFRRGYLDTSFIETHMQELLEKTEDRH--QENKEEVIAAIAATLKKIRESR 480
157415294 403 NKLERALKEFVIDDIRTTIPFLIAITKTREFRRGYLDTSFIETHMQELLEKTEDRH--QENKEEVIAAIAATLKKIRESR 480
34557652  401 NKMKRALGEFTVRGIKTTIPFLINICKDRDFRKGNFDTSYLEKKMGELMPKD------IEEPADIAAVIAAAI----AAR 470
153951249 403 NKLERALKEFVIDDIRTTIPFLIAITKTREFRRGYLDTSFIETHMQELLEKTEDRH--QENKEEVIAAIAATLKKIRESR 480
222823597 401 NRLERALKEFVIDDIRTTVPFLIAITKIREFRRGYFDTSFIETHMEELLEKTEDRH--QENKEEVIAAIAATLQKIKESR 478
57237923  403 NKLERALKEFVIDDIRTTIPFLIAITKTREFRRGYLDTSFIETHMQELLEKTEDRH--QENKEEVIAAIAATLKKIRESR 480
154174589 401 NKLERALEEFTIEGVRTIIPFLLAISKSREFRRGFFDTSYVEKNLKTILENTHDDTn-TDPAADLEEVITEAIKRYRKKR 479
32267348  401 NKLSRALNEFTIKGVKTTIPFLINICNDKDFRRGYFDTSYIESKIKELMPPPQ-----SKPEDDMVSVIVAAL----SAR 471
157165069 401 NKLERALEEFTIEGVRTIIPFLLTISKSKEFRRGFFDTSYVEKNLKTILENTYDDMn-KEPNDDLEEVIVEAIKRYKKKR 479
118475185 401 SKLERALDEFKIEGVRTTLPFLLAISKRRHFRRGFFDTSYIEERLQDILENTQDHH--QENKEEVIAAIAAAIKKVKEDR 478
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap