Conserved Protein Domain Family
PRK08402

?
PRK08402: PRK08402 
replication factor A; Reviewed
Statistics
?
PSSM-Id: 169427
View PSSM: PRK08402
Aligned: 7 rows
Threshold Bit Score: 604.871
Threshold Setting Gi: 14591637
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
14591637    4 MVVLTKEKIIEIIEEK-TGMSREKIEEEIRRIMEEDPhLSEQGAAALLAERLGIDLIEREETSLMKISDLYPGMdpREVN 82 
18978392    1 MSAFTKEEIIKRILEEvEGITLEEIENQIRQIMRENN-ISEHAAALLLAERLGVEVTKREEQPLMKISDLYPGMdpHEVN 79 
14520503   18 MTVLTKDRIIEIIERK-TGMSREEIEEEIRKIMEEDPyLSEQGAAALLAERLGIDLIEKEEVSLMRISELYPGMdpREVN 96 
57641896    1 MEVLTKDEIINRIIRE-RGLSRSEIEEKIRELAKMHG-VSENAAAVMLAEELGVSLGKEEE--MLYIKDLVPGM--TGVN 74 
212225107   1 MVVLTKEQIIEMIERQ-KGLSRNEIEERIAEIASREG-ISEHAAALMLAEELGVNLEGKEE--LLHIADLVPGM--ANVN 74 
240103817   4 MAVLTKEAILELIRSR-TGMSEREINLRIKEIMKREG-IGEHAAALLLAEELGINLEGEEE--ALHIADLVPGM--SGVN 77 
242398695   1 MTVITKEEIVERIRQK-TGMSKEEIEHKIREIAKVNE-ISEHAAALLLAEEFGVK-TDDEGAPLMHISELVPGM--KGIN 75 
14591637   83 IIGRVLKKYPVREYTKKDGSIGRVASLVIYDDSGRARVVLWDGKVAEYYNKIEVGDVIKVLDAQVRESLSGLPELHINFR 162
18978392   80 IVGRILKKYPPREYTKKDGSIGRVASLVIYDDTGRARVVLWDSKVLEYYSKLEVGDVIKVLDAQVRESLSGLPELHINFR 159
14520503   97 VVGRVLKKYPPREYTRKDGSVGRVASLIIYDDSGRARVVLWDAKVSEYYNKIEVGDVIKVLDAQVKESLSGLPELHINFR 176
57641896   75 IVARIKRKFPPREYTRRDGSTGRVADLIIYDSTGQARLVLWDAMVAKYYDDLNVGDVIKVIDPTVKEGMRGV-ELHANFR 153
212225107  75 IVARILRKYPPREYQKRDGSTGQVANVIIYDSTGKTRLVLWDAQVAKYYNELNPGDIIKIIDPSVREGRSGV-ELHANFR 153
240103817  78 IVGRVLRKYPPREYTKRDGSRGVVANLIIYDATGKARLVLWDSQVGKYYNEINVGDVVKVINPSVREGRNGI-ELHVNFR 156
242398695  76 IVGRVLRKYPVREYKKKDGSQGRVAGLLIYDNTGRARVVLWDPEISKYYDDIQVGSVIKIINADVRESLRGLPELHVSFR 155
14591637  163 ARIILNP-EDPRVDSIPPLEEVRIATYTRKKIGDIEPGDRFIEIRGTIAKVYRVLTYDACPECKKKVDYDPGTGVWICPE 241
18978392  160 ARIIKNP-DDPRVQDIPPLEEVRVATYTRKKISEVEPGDRFVELRGTIAKVYRVLVYDACPECKKKVDYDPGMDVWICPE 238
14520503  177 ARIILNP-DDPRVEMIPPLEEVRVATYTRKKIKDIEAGDRFVEVRGTIAKVYRVLTYDACPECKKKVDYDEGLGVWICPE 255
57641896  154 TRIIKNP-EDPRVEEIPPLEEVRSYNYRRVQIKELQGGERFVEVRGTIAKLYRVLVYDACPECRRRVDYDPSTDTWICPE 232
212225107 154 TRIILNP-EDPRVEEIPPLEEVRSYNYRRTKIGELMGGERFVEVRGTIARLYRVTVYDACPECRRKVDYEPATDTWICPE 232
240103817 157 SRVIINPsDDPRVEEIPPLEEVRSYNYRRVKIAELEGGERFVELRGTIARVYRVTVYNACPQCRRKVDYDPATDSWTCIE 236
242398695 156 SRLIINP-DDPRVEEIPPIEEVRSYNYTRKNIGELMDGEKFVEIRGTIAKLYRIIAYDACPQCRRKVDHDSATDTWICIE 234
14591637  242 HGEVEPIKMTILDFGLDDGTGYIRVTLFGDDAEELLGVSSEEIAEKIKELENSGLTTKEAARKLAEEEFYKIIGKEIVVR 321
18978392  239 HGEVEPIKITILDFGLDDGSGYIRITLFGDDAEELLGVGPEEIAQKLKEMESMGMTLKEAARKLAEEEFYNIIGKEIIVR 318
14520503  256 HGEVQPIKMTILDFGLDDGTGYIRVTLFGDDAEELLGVSPEEIAEKIKELEESGLTTKEAARKLAEDEFYNIIGREIVVR 335
57641896  233 HGPVNPVKITVLDFGLDDSTGYIRTTLFGDSAAELIGEEPEVIDEKLKKLIDEGLTPKEAGKRLAEDEYYPLIGKEIVVR 312
212225107 233 HGEIQPIKITIIDFGLDDSTGYIRTTLFGDDAAELLGKDPEEIAEKLRELVEDGLTLKEASRKLAEEEYYYLLGREIVVR 312
240103817 237 HGEVEPVKMTVLDFGLDDGSGYIRITLFGDEAADLLGEDPEVIEEMQKELIEAGATPKEAARKLAEEKFYTILGREIVVR 316
242398695 235 HGEVKPITATILDFGLDDSTGYIRVTLFGDDVVEILGVELEEISEKFKELIKMGMTAREAGRKLAEDEFYHVLGREIFVR 314
14591637  322 GNVIEDRFLGLILRASSWEEVDYRKEIENIKEELEKLGVM 361
18978392  319 GNVIEDRFLGLILRASSWEEVDYKREIERIKRELEELGVM 358
14520503  336 GNVIEDRFLGLILRASSWEDVDYRREIERIKEELEKLGVM 375
57641896  313 GSVVEDKFLGTLFKARSWDEVNEKAEIERVRRELYRELKE 352
212225107 313 GNVVDDKFLGLILKAFGWDEVDYKREISRVRAELKEVTKE 352
240103817 317 GNVIDDKFFGLMLKAFTWDDLDFKREIAMERAQLREALKM 356
242398695 315 GNVVEDRFLGLILKASSWDEVDYKREIERVRKELLREVE- 353
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap