Conserved Protein Domain Family
PRK08395

?
PRK08395: PRK08395 
fumarate hydratase; Provisional
Statistics
?
PSSM-Id: 169425
View PSSM: PRK08395
Aligned: 5 rows
Threshold Bit Score: 271.685
Threshold Setting Gi: 57641899
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
240102375   1 MRLRTPLSMEDVLRLKAGDVVYLSGEIVTARDSAHRRILSlpkEG-LPFNPEGAVIYHCGPVVRKThgsyEIVSAGPTTS 79 
14520703    3 VKLRTPLSPEDVLKLKVGDVVYLSGTIYTARDLAHKRFLS---QG-FPFNPEGSVIYHCGPLVKAG----KIVSAGPTTS 74 
14591448    4 IKLKTPLSLEEILKLNVGDLVYLSGVIYTARDLAHKRFLS---QG-FPFNPEGAVIYHSGPLVKDK----RIVSAGPTTS 75 
57641899    3 VKLKTPLG-EEVLELRAGDVVYLSGRIYTARDAAHRKILElskKGkLPFELEGAVIYHCGPVVRRKedgwKVVSAGPTTS 81 
18978126    3 VRLKTPLTWEDIRDLEIGDRVLLSGIVYTARDLAHRRFLE---EG-FPFNPEGAVIYHCGPLIKNG----IVVSAGPTTS 74 
240102375  80 ARMNLYLDGVLDLGVRGIIGKGGMKAEPFRGRAVYFAFTGGAGSLAAKSIkRVRAVHW-LDLGIPEALWVLEVEDFPLLV 158
14520703   75 ARMNQYLDFLFSKGVRGIIGKGGMNAEKFKGKAVYLAFPGGAGSLAAKHL-KVKNVYW-EDLGMADAVWELEAKDLPLLV 152
14591448   76 TRMNPYLDFLFSKGIRGIIGKGGMNPEPFKGKAVYFAFPGGAGSLAAKHL-TIKNVYW-EELGMTDAVWELEAKELPLLV 153
57641899   82 ARMNRYLDEILSLGVRGIIGKGGMEVGPFVGRAVYFAFTGGAGSLAAESVkRVVDVYWlDELGIPEAVWVLEVEDFPLLV 161
18978126   75 ARMEKYLDFLFNRGVRGVIGKGGMNHEKFKGRAVYFSYPGGAGSLAREFIvKVRDVYW-EDLGMTDAVWELEVRDMPLLV 153
240102375 159 AIDAHGNSLYR 169
14520703  153 AIDSKGRSLYS 163
14591448  154 AIDAKGRSLYD 164
57641899  162 AIDSRGNSLYR 172
18978126  154 SIDSKGRSLYR 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap