Conserved Protein Domain Family
PRK08392

?
PRK08392: PRK08392 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 169423
View PSSM: PRK08392
Aligned: 7 rows
Threshold Bit Score: 405.706
Threshold Setting Gi: 240103989
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18977862    1 MDLHTHTIYSDGIGSVIDNVNMAEIRGLRLLGISDHIHFFTPSKFLKYVNEVRSIGREAEIPVLVGIEANITENGPDVTE 80 
14521038    2 MDLHTHTIYSDGIGMVRDNVAWAEKRGLKIVGISDHIHYFTPSKFSAYINEIRIAKEESDIVVLAGIEANILENGPDITD 81 
14591128    2 MDLHTHTVYSDGIGLIRDNVAWAEKRGLKIVGISDHIHFFTPSRFSAYINEINVIKEESEIVVLAGIEANILENGPDITD 81 
57640262    6 HDTHTHTVYSDGIGSIADNIASAEEKGLKLLGITDHSHYVVGKTFNRYIREIRRWGNESEITVLTGIEGNITPNGVDVPD 85 
212224226   4 IDLHTHTTYSDGTGSVPENIAAAEQKGLRLLGISDHIHYLTPKSLNRYVREIRQWSESAELVVLAGVEANIMHGGVDITT 83 
240103989   5 HDAHTHTLHSDGLGEVFENIAEAERKGLSLVAITDHSHYLLRGNFNAYLSEIRRWGEDSEITVLAGIEGNITPNGVDVPD 84 
242399379   1 MDLHTHTRFSDGIGDIRDNIAEAERKGLRIVGISDHIHFFTPHVLNSYLSLINQAKKDSETIVLAGMEANILPEGVDITD 80 
18977862   81 DFAKHLDYVIASVHDWFGEGEVYRYIERIKLALMDENVTIIGHFGNVFPWIGYPTEEQIKEVLDVAEEYGKAFEISSRYR 160
14521038   82 EFRKRLDYVIASVHEWFGRDGAHMYIEYVKRAIMDDNVDIIGHFGNSFPWIGYPTEEEIREVLELAEAYGKAFEISSRYK 161
14591128   82 EFRKKLDYAIASVHEWFGRNGTHEYINYVKKAIMDDNVDIIGHFGNSFPWIGYPTREEIDEILDLAEAYGKAFEISARYK 161
57640262   86 FVAEKLDYVIASVHEWVDTPN--EYLDLVKLALMDENVDVIGHFGANFPYVGFPSVEELNEVLELAEAKGKAFEISSRYR 163
212224226  84 DIAKKLDYVIASVHLWVETPE--EHVELVKLALQDENVDIIGHFGASFPYTGYPSEEGLREILELAEANGKAFEISSRYK 161
240103989  85 WMAKKLDFVIASVHEWVDRPE--QYVELVRVALLDENVDVIGHFGASFPYIGYPPWEDLLELITLAEENGKAFEISSRYR 162
242399379  81 DLRKRLDYVIASVHMYFNPGSHHKYLELVKTAIQDENVDIIGHFGNVFSYIGHPSIKDYKEIIDLAEEYGKGFEISTRYR 160
18977862  161 VPDLEFVKMCIKRGIKLVFASDAHRPEDVGRVDWSIKVFEKAGGKKEDLLFSEMI 215
14521038  162 VPDLEFIKECIRRGIKLSLATDAHRPEDVGKISWSLKMFEKAGGSKEDLVFSEYL 216
14591128  162 VPDLEFIRECVKRGIKLSLATDAHRPEDVGKVSWSLKMLEKAGGTKEDLIFSEYL 216
57640262  164 VPELDFIRECIKRGIKLTFASDAHFPEGVGNVGWSEKVFKKAGGKKEDLLFEEFL 218
212224226 162 VPELDFIRACIKRGIKLTFASDAHWPRSVGNVSWSEKVFRKAGGTKEDLFFGELL 216
240103989 163 VPDLEFVRECIRRGVKLTFASDAHRPEKVGNVGWSVSIFKKAGGKLEDLLFEEFL 217
242399379 161 VPELDFIKFCIKRGVKLVFGSDAHQPKDVGNINWGLKAFKRAGGKKEDLIFSELL 215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap