Conserved Protein Domain Family
PRK08387

?
PRK08387: PRK08387 
putative monovalent cation/H+ antiporter subunit B; Reviewed
Statistics
?
PSSM-Id: 169420
View PSSM: PRK08387
Aligned: 6 rows
Threshold Bit Score: 151.498
Threshold Setting Gi: 14590794
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242398830   1 MSLIVRTTTKLVSPFLVVYSTYLMMYGHLSPGGGFQAGVILAVSIILLITSHGYKKVRKTFKFWEVQLIEGVSGVFLVSL 80 
57640558    3 MSLVVRTTTKLVAPFLVTYGAYLTIYGYESPGGGFQAGVIFAVSVILLMTAYGYRRTRKHFPLRTVQLVESSAALFIVGT 82 
212224479   3 MSIVVRTTTKLVSPFLVTYAAYLMLYGHLSPGGGFQGGVILAVAVILLITSHGYKKVRKKFKFNWASLIESSAGAMLVLL 82 
33359547    4 MSIVARTTTKLVAPFLTTYAAYLMIYTTQSPGGGFQAGVILAVALILLITSHGYKSVRKYFRKRVASSLESVGGLATI-- 81 
14590794    3 MSLIARTTSKLVAPFLVTYAAYLMLYGAYSPGGGFQAGVILAVAVILLITSHGYRKVRKRFRKKAVSSLETSSGLGIA-- 80 
14521411    3 MSLIARTTSKIVAPFLVTYAAYLILYGAYSPGGGFQAGVILAVAVILLITSHGYKKVKKRFRGRTVSYLESLSSLGIA-- 80 
242398830  81 GIISLLFGGFFFNFLRggsfgslLSGGIVPLFNIGVALKVGAAFTFMFYILLRWVEHD 138
57640558   83 AIAGLAFGAFFFNFLRp-----yIPGGTVMTFNIGVALKVGTSFVLVFYILSRWVDRD 135
212224479  83 GITGLAFGAFYANFLP-------TEGGIILPFNVIVGLEVGAAFTFVFYILLRWVESD 133
33359547   82 ----TIFFLTVLLFLR-------PSEVYVVPANVFIGLKVGAAFTLMFYALISVLERD 128
14590794   81 ----FLLLLLALTSLN-------PNENLIGSFNILAGIKVGAAFVLIFYSLIAFLERD 127
14521411   81 ----LLIALVALAYLR-------PRDDIVTSFNVLVGIKVGAAFVLIFYSLIAFLERD 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap