Conserved Protein Domain Family
PRK08382

?
PRK08382: PRK08382 
putative monovalent cation/H+ antiporter subunit E; Reviewed
Statistics
?
PSSM-Id: 169415
View PSSM: PRK08382
Aligned: 6 rows
Threshold Bit Score: 354.478
Threshold Setting Gi: 57640553
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18977525    1 MSRMPLYLKHRVEKVKERYLYEIYESKKLPPWERFLLTWAILLGFWVIITGDLTIRGLSLGIATTGIIAYYMRDLLTEDI 80 
14590798    1 MTRIHLYLRKRVEEVKERYRYEIYEKQKLSPWERFAITWLILLVFWLGITGDLSYRGLILGFPTTAIISYYLRDFLTEDI 80 
14521407    1 MTRMHLYLRKRVEEVKERYRYEIYEMQKLPSWERFVLTWVTLMAFWLGISCDLSYRGVTLGAITTAIISFYLRDFLTDDV 80 
57640553    1 MSRMHFYLRQRLEEVRKRVLYESYEAQKLPAWERAGITWLALFAFWIIISGKFSPSHVITGALVTLLIAIITRDFLTDDI 80 
212224484   1 MSRIPFYLKERLENLRERVLHERFEASKLPVWERIILTWAPLLAFWVVISANLEPRNLFLGATVTLIIASFMRDMLTEDI 80 
242398825   1 MSRVPFYLRERLDDVKQRVLFETYEAQKLPKWEQVVLTWILLFSFWTIISANLKAENLLIGGLATLVISSFMHEMLTEDI 80 
18977525   81 RHSKHLVWKILYFLLIYLPQYLIIMAFRLLESNIKVARHVIFMDINPAIVKIKSDLHSNTGITLLANSITLTPGTLTLDV 160
14590798   81 RHSKHLAWKILYFAFIYLPQYLIIMGFRLLESNLKVAKHALLMDINPGIVKIRTDLHSDTGITILANSITLTPGTLTLDV 160
14521407   81 RHSKHLAWKILYFALIYFPQYLMIMAFRLLESNIKVARHAILMDINPGIVKIKTTLHSDTGITILANSITLTPGTLTIDV 160
57640553   81 RRTGHLLSKAAYIFLFLVPQYLFIMAFRLLESNLRVVKNVILMDINPGIVKVKADLHSDTGLTVLANSITLTPGTLTLDV 160
212224484  81 RRTGHVLEKLLYFTFLYLPQYLIIMAFRLIESNLKVAKNVIFLDIHPGIVKIKTDLHSDTGVTILANSITLTPGTLTLDV 160
242398825  81 RRSGHILEKILYISFFVIPQYLFIMAFRLIESNFKVAKHAVFMDINPGIVKIKTELHSNTGVTILANSITLTPGTLTLDV 160
18977525  161 VRRLDGTYLYVHWIDAETLNPEKAGEVIKGDIEKWLKKMFW 201
14590798  161 VKKLDGTYLYVHWIDVETLNVEKAGEIIKGDIEEWLKKMFW 201
14521407  161 AKKLDGTYLYVHWIDVETLNVERAGELIKGDIEEWLKKVFW 201
57640553  161 TKKLGEAYLYVHWIDVETLDGEKAGMKIKGELEEWLKKIFW 201
212224484 161 SKKLGETYLYVHWIDLETLNREKAGEKIKGDIEEWLKKVFW 201
242398825 161 NKKLGETYLYVHWISVEALNREKAGEKIKGDIEGWLRKIFW 201
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap