Conserved Protein Domain Family
PRK08381

?
PRK08381: PRK08381 
putative monovalent cation/H+ antiporter subunit F; Reviewed
Statistics
?
PSSM-Id: 169414
View PSSM: PRK08381
Aligned: 6 rows
Threshold Bit Score: 107.517
Threshold Setting Gi: 57640554
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242398826  1 MVEEDLLVNPFgWgvlILIATSLILSYRVLFGPTLADRIVGINTVTTKLVVILAIFGFIMEEYFFLDLAIVLLMVNAVGG 80 
18977524   1 MVKEDVLVAGI-W---ILLATAIIASYRVIFGPSLADRVVGLNTITTKIVGAIAILSVLWREWYLLDIAIVLLMVNSVGG 76 
212224483  1 MAQESLLVSTF-Y---LLVFTAILITYRVVRGPTLPDRIVGLNTITTKVVMIIAIVSVIRKEYYLIDLAIVLLMVNAVGG 76 
14521408   1 MAQEGFLVAGI-W---ILLGTALMAMYRVIAGPTLPDRVVGLNTITTKIVGILTILAILWREYYLIDMAIVLLMVNSIGG 76 
57640554   1 MAQENFLVVLP-YavaFLVFTATLVSYRVIFGPTLADRAVALNTATTKAVVIIAMLSILYDAPYLLDVSIVLLMVNAVGG 79 
33359348   1 MAQENVLVAGV-W---VLLGTALMAMYRVITGPTLPDRIVGLNTITTKVVGILAILGVLWEEYFLIDMAIVLLMVNSVGG 76 
242398826 81 LILAKYMEGAG 91 
18977524  77 LIIAKYMERRG 87 
212224483 77 LILAKYLERRA 87 
14521408  77 LILAKHMERRG 87 
57640554  80 LIIAKYLEVRA 90 
33359348  77 LMLAKHMERMK 87 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap