Conserved Protein Domain Family
PRK08381

?
PRK08381: PRK08381 
putative monovalent cation/H+ antiporter subunit F; Reviewed
Statistics
?
PSSM-Id: 169414
Aligned: 6 rows
Threshold Bit Score: 107.517
Threshold Setting Gi: 57640554
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242398826  1 MVEEDLLVNPFgWgvlILIATSLILSYRVLFGPTLADRIVGINTVTTKLVVILAIFGFIMEEYFFLDLAIVLLMVNAVGG 80 
18977524   1 MVKEDVLVAGI-W---ILLATAIIASYRVIFGPSLADRVVGLNTITTKIVGAIAILSVLWREWYLLDIAIVLLMVNSVGG 76 
212224483  1 MAQESLLVSTF-Y---LLVFTAILITYRVVRGPTLPDRIVGLNTITTKVVMIIAIVSVIRKEYYLIDLAIVLLMVNAVGG 76 
14521408   1 MAQEGFLVAGI-W---ILLGTALMAMYRVIAGPTLPDRVVGLNTITTKIVGILTILAILWREYYLIDMAIVLLMVNSIGG 76 
57640554   1 MAQENFLVVLP-YavaFLVFTATLVSYRVIFGPTLADRAVALNTATTKAVVIIAMLSILYDAPYLLDVSIVLLMVNAVGG 79 
33359348   1 MAQENVLVAGV-W---VLLGTALMAMYRVITGPTLPDRIVGLNTITTKVVGILAILGVLWEEYFLIDMAIVLLMVNSVGG 76 
18977524   1 MVKEDVLVAGI-W---ILLATAIIASYRVIFGPSLADRVVGLNTITTKIVGAIAILSVLWREWYLLDIAIVLLMVNSVGG 76 
212224483  1 MAQESLLVSTF-Y---LLVFTAILITYRVVRGPTLPDRIVGLNTITTKVVMIIAIVSVIRKEYYLIDLAIVLLMVNAVGG 76 
14521408   1 MAQEGFLVAGI-W---ILLGTALMAMYRVIAGPTLPDRVVGLNTITTKIVGILTILAILWREYYLIDMAIVLLMVNSIGG 76 
57640554   1 MAQENFLVVLP-YavaFLVFTATLVSYRVIFGPTLADRAVALNTATTKAVVIIAMLSILYDAPYLLDVSIVLLMVNAVGG 79 
33359348   1 MAQENVLVAGV-W---VLLGTALMAMYRVITGPTLPDRIVGLNTITTKVVGILAILGVLWEEYFLIDMAIVLLMVNSVGG 76 
242398826 81 LILAKYMEGAG 91 
18977524  77 LIIAKYMERRG 87 
212224483 77 LILAKYLERRA 87 
14521408  77 LILAKHMERRG 87 
57640554  80 LIIAKYLEVRA 90 
33359348  77 LMLAKHMERMK 87 
18977524  77 LIIAKYMERRG 87 
212224483 77 LILAKYLERRA 87 
14521408  77 LILAKHMERRG 87 
57640554  80 LIIAKYLEVRA 90 
33359348  77 LMLAKHMERMK 87 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap