Conserved Protein Domain Family
PRK08374

?
PRK08374: PRK08374 
homoserine dehydrogenase; Provisional
Statistics
?
PSSM-Id: 169409
View PSSM: PRK08374
Aligned: 7 rows
Threshold Bit Score: 515.511
Threshold Setting Gi: 14521117
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242399452   2 NSLSLSIIGFGNVGRGVAEVLYTKMPHFkkkyGINIKVVSITDTSATIWdqEAINLREAIETKNHFGSLKFWGnEYEVYK 81 
14590910    1 MKVNISIFGFGTVGRALAEIIAEKSRIF----GVELNVISITDRSGTIW--GDFDLLEAKEVKESTGKLSNIG-DYEVYN 73 
18977476    2 KEVKISIFGFGTVGRALAEIVAENSEVY----GIKLKVVSITDRSGTLW--GDFDLLEAKEVKEATGKISNIG-DYEVYY 74 
212223181   1 MEVKLSLFGFGNVGRAVARVLLEKETFFkerySLSFKVVSIADTSGTVWlpESIDLREALTVKETFGKLSAWTnDYEVYN 80 
14521117    1 MKVKVSVFGFGTVGRALAEIIAEKRKVF----GVELNVVSITDRSGTIW--GDFDLLEAKEVKESTGKLSNIG-EYEVYD 73 
240104088   1 MEVKVGLFGFGNVGRAVARVLLEKERFFreryGLSFRVVSISDTSGTVWlpEGIDLSEALLVKENFGKLSAWTnDYEVYN 80 
57641562    2 REIRVSLIGFGNVGRATAGVLLEKSRLFeeryGVRISVVSISDTSGTVWlpEGIDLREALLVKENFGRLSAWTnDYEVYE 81 
242399452  82 LDPMEVVKEIDADVIIDVTNDKNASKWHLEALKRGKGVVTSNKPPVVFDYKELVDLANSKNLPYLFEATVMAGTPIINLL 161
14590910   74 FSPQELVEEVKPNILVDVSSWDEAHEMYKVALGEGISVVTSNKPPIANYYDELMNLAKENNAGIFFESTVMAGTPIIGVL 153
18977476   75 LKPEEIIEEIRPDIFVDVSSWDDAARVYEFALKEGVSVVTSNKPPIAESYDKLLKASQEGNAGLFFEATVMAGTPIIGLL 154
212223181  81 FTPKEAVQEIDADIVIDVTNDKNAYGWHLTALRDGKAVVTSNKPPLAFHYAELMEEANKRSLPYLFEATVMAGTPIITLL 160
14521117   74 FSPQELIEEVKPDILVDVSSWDDAHEMYSYALAEGISVVTSNKPPIANHYDELITLARENGVGIFFESTVMAGTPIIGLL 153
240104088  81 FSPVEAVKEIEADIVIDVTNDKNAHEWHLEALRDGKAVVTSNKPPLAFHYAELTDEAERRGLPYLFEATVMAGTPIIGLL 160
57641562   82 LTPEEIVGEVDSEIVVDVTNDKEAWTWHLRALKEGKGIVTSNKPPLAYHYREILNEAEKRELPYLFEATVMAGTPIVGLL 161
242399452 162 KEEILADSVKRISGVFNGTTTFILTSIETGMTFKEALKQAQTAGIAERDPSNDLKGIDAAYKATILHHLAF--YPIDFKE 239
14590910  154 RENLLGENIKRIDAVVNASTTFILTKMSEGKTLDDAIEEAKSLGILEEDPSKDIDGIDAYYKAKILHWVSYgePPEEEER 233
18977476  155 RENLLGEKIEEIKAVVNASTTFILTRMEQGKTFEEAFNEAKSLGVLEEDPSKDIDGIDAFYKAKILHWVSYgaPPEFEER 234
212223181 161 RHGLRGDTVERIEAVLNATTTFILSEMEKGLDFDDALKEAQKLGIAERDPSGDILGIDAGYKATILHCLAF--EPITFDM 238
14521117  154 RENLLGEEIVKMEAIVNASTTFILTRMENGKTFEEAMEEARTLGILEEDPSKDIDGIDAYYKAKILHWVSYgeQPEEEER 233
240104088 161 RENLLGDTVRKIKAVLNATTTFILSRMEQGIDFEKAVRQAQELGIAERDPSGDVLGIDAGYKATILHCVAF--KPITFDE 238
57641562  162 RENLLGDDVQRIEAVLNATTTFILTQMEMGLSFEEALAKAQRLGIAERDPSGDILGIDAGYKATILHCLAF--HPITYNE 239
242399452 240 VHIEGIENlseeeireakkeGTPFRLVATVEEGKVEIKPKKVYENGPLAVSGTSNVAVIETDLLGELMLKGSGAGIKETA 319
14590910  234 LGIREVRD------------ARNVRLVAQVSKGKISVKPRKLSSDNPLLVEGVQNAAVIRTNNLGEVILKGPGGGGRVTA 301
18977476  235 VGIREVKD------------ARNVRLVAQVSEGRISVKPIKLPENSPLLVEGVQNAAIIKTDNLGEVVLKGPGGGGRVTA 302
212223181 239 ASVKGIVEvtpgeierakakGKTIRLVATVEEGRIVVGPKEIPKNSPLAVESHENAAVIKTDLLGELVIKGAGAGLKETA 318
14521117  234 EGIRNVKD------------ARNVRLVAEISKGRISVAPRKLPDNSPLLVSEVENAALIKTENL-TLTLKGPGGGGKVTA 300
240104088 239 IAVKGIAEvtvdevkralakGKRIRLVATIEEKNVRVTPEEV--SGPLTVSSNENVALIETDLLGELLVKGAGAGLKETA 316
57641562  240 IEVRGIAEvtegdierakakGKTIRLVARIEKGNVAVEPAEIPKESPLAVESHENAAVIKTDLLGELLIKGAGAGLKETA 319
242399452 320 SGVVGDIIRAAVSIYKYL 337
14590910  302 SGVFTDIIKATLKFPNLR 319
18977476  303 SGVFTDIIKAALRFPKAR 320
212223181 319 SGVVSDIVMAALMMR--- 333
14521117  301 SGVFTDIIKAALKFPSPR 318
240104088 317 SGVVSDLVKASLKLRAG- 333
57641562  320 SGVISDVIKAALRLV--- 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap