Conserved Protein Domain Family
vorA

?
PRK08366: vorA 
2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed
Statistics
?
PSSM-Id: 169406
View PSSM: PRK08366
Aligned: 7 rows
Threshold Bit Score: 799.21
Threshold Setting Gi: 242399358
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242399358   1 MPKKVISGNYAAAYAAKHARVEVVAAYPITPQTSIIEKIAEFIANGEVEnLEYVPVESEHSAMAACIGASAAGARTFTAT 80 
18977341    5 PIRKVVSGNYAAAYAALHARVQVVAAYPITPQTSIIEKIAEFIANGEAD-IQYIPVESEHSAMAACIGASATGARTFTAT 83 
14521565    6 PIKKVVSGNYAAAYAVLHARVQVVAAYPITPQTSIIEKIAEFIANGEAD-IQYIPVESEHSAMAACIGASATGARVFTAT 84 
14590562    8 PIKKVVSGNYAAAYAALHARVQVVAAYPITPQTSIIEKIAEFIANGEAD-IQYIPVESEHSAMAACIGASATGARVFTAT 86 
240102323   6 PIRKVVSGNYAAAYAVKHARVQVVAAYPITPQTSIIEKIAEFIANGEAD-IQYVPVESEHSAMAASIGASAAGARAFTAT 84 
57641915    5 PIRKVVSGNYAAAYAALHARVQVVAAYPITPQTSIIEKIAEFIANGEAD-IQYVPVESEHSAMAACIGASAAGARAFTAT 83 
212224629   5 PIRKVVSGNYAAAYAAKHARVEVVAAYPITPQTSIIEKIAEFIANGEVEnLQYVAVESEHSAMAACIGASAAGARAFTAT 84 
242399358  81 SAQGLALMHEMLHWAAGARLPVVMVDVNRAMAPPWSVWDDQTDSLAQRDTGWLQFYAENNQEVYDGVLMAFKIGehEKVN 160
18977341   84 SAQGLALMHEMLHWAAGARLPIVMVDVNRAMAPPWSVWDDQTDSLSQRDTGWMQFYAENNQEVYDGVLMAYKVA--ETVN 161
14521565   85 SAQGLALMHEMLHWAAGARLPIVMVDVNRAMAPPWSVWDDQTDSLSQRDTGWMQFYAENNQEVYDGVLMAFKVA--ETVN 162
14590562   87 SAQGLALMHEMLHWAAGSRLPIVMVNVNRAMAPPWSVWDDQTDSLSQRDTGWMQFYAENNQEVYDGVLMAYKVA--ETVN 164
240102323  85 SAQGLALMHEMLHWASGARLPVVMVNVNRAMAPPWSVWDDQTDSLAQRDTGWMQFYAENNQEVYDGVLMSFKVA--ETVN 162
57641915   84 SAQGLALMHEMLHWASGARLPIVMVDVNRAMAPPWSVWDDQTDSLAQRDTGWMQFYAENNQEVYDGVLMAFKVA--ETVN 161
212224629  85 SAQGLALMHEMLHWASGARLPIVMVDVNRAMAPPWSVWDDQTDSLAQRDTGWMQFYAENNQEVYDGVLMAFKVA--ETVN 162
242399358 161 LPVMVIESAFILSHTYDIVDMLEQEEVDEFLPPRKPLYSLTDFD-NPFSIGALGTPADYYEFRYKIAKAMEEAKKIIKEV 239
18977341  162 VPAMVVESAFILSHTYDVVEMIPQELVDEFLPPRKPLYSLANFD-EPIAVGALATPNDYYEFRYKLAKAHEEAKKVIKEV 240
14521565  163 VPAMVVESAFILSHTYEIVNMIPQELVDEFLPPRKPLYSLADFE-NPIAVGALATPADYYEFRYKLARAHEEAKKVIKDV 241
14590562  165 IPTMIIESAFILSHTYEVVNMIPQELVDEFLPPRKPLYTLTDFE-NPIAVGALATPADYYEFRYKIAKAHEEAKKVIKSV 243
240102323 163 VPAMVIESAFILSHTYDVVEMIPQELVDEFLPPRKPLYDLADFS-RAISVGALATPNDYYEFRYKLAKAMEDAKKVIKDV 241
57641915  162 LPAMVVESAFILSHTYDVVEMIPQELVDEFLPPRKPLYDLADFErEPFSVGSLATPADYYEFRYKIQKAMEEAKKVIKEV 241
212224629 163 LPAMVVESAFILSHTYDIVEMIPQELVDEFLPPRKPLYTLTDFD-NPVSVGALGTPADYYEFRYKIEKAMEKARKVIKEV 241
242399358 240 GKEFGEKFGRDYSQMIELYKTEDADIVFMGMGSLMGTVKEAVDIFRSEGYKVGAAKVRWFRPFPREELYELAKSVEGIAV 319
18977341  241 GKEFGERFGRDYSQMIETGYIDDADFVFMGMGSLMGTVKEAVDLLRKEGYKVGYAKVRWFRPFPKEELVEIAESVKGIAV 320
14521565  242 GREFGERFGRDYSEMIEKAYIDDADFVFMGMGSLMGTVKEAVELLRKQGYKVGYAKVRWFRPFPREELLEIAESVKGIAV 321
14590562  244 GKEFGERFGRDYSKMIETGYIEDADFVFMGMGSLMGTVKEAVDLLRKEGYKVGYAKVRWFRPFPKEELLEIAESVKGIAV 323
240102323 242 GKEFGERFGRDYSEMIEKGYVDDADFVFMGMGSLMGTVKEAVDLLRKEGYKVGYAKVRWFRPFPKEELLEIAESVKGIAV 321
57641915  242 GREFGERFGRDYSQMIETYRTDDADFVFMGMGSLMGTVKEAVDILRQEGYKVGAAKVRWFRPFPKEELYELAKNVDGIAV 321
212224629 242 GKEFGEMFGRDYSQMIELYRTDDADFVFMGMGSLMGTVKQAVDILREEGYKVGAAKVRWFRPFPKDELYELAKNVEGIAV 321
242399358 320 LDRNFSFGQEGILFNEAKGILYNTDANPIMKNYIVGLGGRDLTVNDVRKIASNMKKIIEKGELDKEIDWYHLKR 393
18977341  321 LDRNFSFGQEGILFTESKGALYNSSAHPLMKNYIVGLGGRDVTVKDIKAIADDMKKVIESGKVDKEVVWYHLKR 394
14521565  322 LDRNFSFGQEGILFTEAKGALYNNGARPIMKNYIVGLGGRDFTVSDVKAIAEDMKKVIESGKLDREVEWYHLKR 395
14590562  324 LDRNFSFGQEGILFTEAKGALYNTGVRPIMKDYIVGLGGRDFTVRDVKAIAEDMKKVVESGKLDKEIEWYHLKR 397
240102323 322 LDRNFSFGQEGILFNEAKGVLYNTSARPIMKNYIVGLGGRDFTVPDVKAIAEDMKRVIEAGKLDREVEWYHLKR 395
57641915  322 LDRNYSFGMEGILFTEAKGALYNTDAKPLMKNYIVGLGGRDFTVNDVRKIAENMKAVIEKGELDVEVDWYHLKR 395
212224629 322 LDRNFSFGQEGILFNEAKGVLYNTDARPIIKNYIVGLGGRDFTVSDVKKIAENMKAVIEKGELDVEVDWYHLKR 395
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap