Conserved Protein Domain Family
PRK08359

?
PRK08359: PRK08359 
transcription factor; Validated
Statistics
?
PSSM-Id: 169401
View PSSM: PRK08359
Aligned: 7 rows
Threshold Bit Score: 262.115
Threshold Setting Gi: 212224456
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57640061    1 MGKAKPKYCEICGAPIRGPGHRIRIERAEVLVCDKCYEKYGGkKPGTFSIMPTgRQPRRTAkpASRPKPQPRPYQPKPLV 80 
14521481    5 MAKAKPRYCELCGREIRGEGHIIRIEGAELLVCDDCYRKYGR-KPGTFSIMPR-REPTRRL--TPSKPRTPTIRRERPLI 80 
14590651   26 MAKAKPKYCELCGREIKGEGHIIRIEGAELLVCDDCYRKYGR-KPGTFSIMPR-REPRRRI--TSSKPRVPSVRREKPLI 101
18976884    1 MAKAKPRYCELCGREITGQGHVVRIEGAELLVCDDCYRKYGR-KPGTFSIMPR-REPTRIT--TSTPRKRMSPPRERPLI 76 
212224456   1 MAKAKPKYCEICGAPIRGPGHRIRLEGAEVLVCDRCYEKYGRkKAG-FSIMPTgRQPVRRTysRPKPKPAPKPRTERPLY 79 
242398790   4 MAKAKPRICEICGAEIGGKGHTVKIEGAELLVCHRCYEKYGRkKPGTWSPMPTgREPRRRY--ASKPRSKPAPTRRKPLY 81 
240102511   4 MSKAKPRYCEICGAPIRGPGHRIRLEGAEVLVCDRCYEKYGRkKSG-FSIMPTgREPRRRPvsAPRPKREPKPYRERPLY 82 
57640061   81 TEEIVEDFAERVYRAIQRSGKSYEELSHEIGLSVNDLRAIAHGYREPTIKEARKLERYFKIKLIESAgEESFEEKKTIPR 160
14521481   81 TEDIVEDYAERVMEAIRKSGLSYEELSHKVGLSVNVLRRIAHGEYTPTIEEAKKLERFFKIKLVERV-EADFEQKPIIPR 159
14590651  102 TEDIVEDYAERVMEAIRKSGLSYEELSHKVGLSVNLLRRIAHGEYTPTIEEARKLERFFKIKLVEKV-EADFEQKPVIPR 180
18976884   77 TEDIVEDYAEIVSEAIRKSGLSYEELSHKVGLSVNVLRRIAHGEYTPTIEEARKLEKFFKIKLIERV-EPQFEEKPRIPK 155
212224456  80 TEEIVEDFAERVYRAIQRSGKSYEELSHEIGLSMKDLRAIAHGYREPTIKEAKKLEKYFKITLIERV-EEEVKEKVTIPK 158
242398790  82 TEDIVEDYADRVREAIQKSGLSYEELSHMVGLSTNLIRRIAHGEYIPTIDEAKKLERYFKIKLIERV-EEEVKEKASIPK 160
240102511  83 TEEIVEDFAERVYRAIQRSGKSYEELSHEIGLSVNDLRAIAHGYREPTIKEAKKLERYFKITLIERV-EEEFKEKKTIPK 161
57640061  161 DYEPTLGDIANIRIKKRKK 179
14521481  160 DYEPTLGDIARIKIRKKKK 178
14590651  181 DYEPTLGDIARIKVKKKKK 199
18976884  156 DYEPTLGDIARIKVKKRKK 174
212224456 159 DYEPTLGDIANIKIRKRKK 177
242398790 161 DYEPTLGDIANIRVKKKKK 179
240102511 162 DYEPTLGDIANIRIRKRKK 180
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap