Conserved Protein Domain Family
PRK08356

?
PRK08356: PRK08356 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 169400
View PSSM: PRK08356
Aligned: 7 rows
Threshold Bit Score: 325.966
Threshold Setting Gi: 18976738
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
14521731    1 MGMEKMIVGIAGKIAAGKTTVAKFLEEFGFCRISCSEPLFDILTGNTQGYSWVPEVEFKGEPTRENLIELGRILKEKYGE 80 
242398181   4 IEGGKMIVGVVGKIAAGKTTVAKFFEEKGFCRVSCSDPLIDLLTHNLSKYSWLPEIPEKSEPTRDKLIEYGRHLKKTFGE 83 
57642127    1 MEAGKMIIGVVGKIAAGKTTVAKFFEEKGFCRVSCSDPLIDLLTHNVSDYSWIPELPKKAEPTRDRLIEFGKYLKDKYGG 80 
18976738    2 VGVEALIIGIAGKIAAGKTTVAKFLEELGFCRISCSEPLVDILTGNISPYSWVPEVDFKGEPTRENLIKLGRLLKEKYGE 81 
212224593   1 -----MIVGVVGKIAAGKTTVAKFFEERGFCRVSCSDPLIDLLAHNVEDYSWIPELPEQAEPTREKLIEFGKYLKDKYGG 75 
14590417    1 MGVEKTIVGIAGKIAAGKTTVAKFLEELGFCRISCSEPLLDILTGNVSEYSWVPEVNFKGEPTRENLIELGRLLKEKYGE 80 
240104148   1 -----MIIGVVGKIAAGKTTVARFFEEKGFCRVSCSDPLIDLLTHNVSDYSWIPELPEKAEPTREKLIEFGKYLKDKYGG 75 
14521731   81 DILIRLAVDKLRNCENIAIDGVRSMGEVDAIKRMGGIVVYIEAKPEIRFERLRRRGSSKDRGIKSLEDLLKFDEWEEKLY 160
242398181  84 DILIRLALDKKRNCKNVVIDGVRSKGEIEAIKKQGGFIIYVEARPKIRYERLKRRNAGKDKAIKSFEDFLNADEAEEKLY 163
57642127   81 DILIRLAVDKKRHCKNIVIDGVRSREEVETIKRLGGKVIYVEARPEIRYERLRKRRAEKDRVIQSFEDFLKMDEEEEKLY 160
18976738   82 DILIRLAVDKLRHCENIAIDGVRSIGEVEAIKKMGGSLIYVEAKPEIRFERLKLRGAEKDKGINSLEDLLKFDEWEESLY 161
212224593  76 DILIRLAIDKKRHCKNIIIDGVRSREEIEAIKRFGGKVIYVEAKPEIRFERLVRRKAGKDKSIKSFEDFKRMDDAEEELY 155
14590417   81 DILIRLAIDKLRRCKNIAIDGVRSLGEVEAIKRMGGIIIYIEARAEVRFERLRKRCSEKDRGIKTLQDLLRFDEWEERLY 160
240104148  76 DILIRLAVDKKRNCEKVVIDGVRSREEIEAIKRLGGKVIYVEAKPEIRFERLMRRKASKDKGIKTFEDFRAMDDAEERLY 155
14521731  161 ETTKIKEKADIVIVNEGTLEELRDKIISAlgLGKHVH 197
242398181 164 HTRMLKDLADFLIVNEGSLEDLKKRVNTV--ITSLTS 198
57642127  161 HTTKLKDIADYVIVNEGTLEELREKVEEI--ISEVMG 195
18976738  162 KTSELKKVADFIIVNEGSLEELKKEVEEI--VRSLSK 196
212224593 156 QTSKLKDMADYVVVNEGTLEELRRRVEKI--LERLKI 190
14590417  161 STTNIKEKADFVILNEGSLEELKKKVREI--LREHSN 195
240104148 156 HTSELKELADYVIVNEGTLEELREKVERI--IEELSK 190
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap