Conserved Protein Domain Family
PRK08354

?
PRK08354: PRK08354 
putative aminotransferase; Provisional
Statistics
?
PSSM-Id: 169399
View PSSM: PRK08354
Aligned: 9 rows
Threshold Bit Score: 431.845
Threshold Setting Gi: 150020752
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154250050   1 MHGGIN--DGTLIDFSISVNPFIPDFVKEALKES-VKYERMYTYVEWLEDEFRKKFGVDSVIVAGATEAFHIIGWTFVKD 77 
14520265   10 HHGGARrnEIKLIDFSASVNPYPPEWVDEMFKRA-REISFSYPYYEELEDELSELLNEEITITAGITEGLYLLGILALRG 88 
18976665   10 SHGGSR--EEGYIDFSASVNPYPPEWTDEMFERA-KKISTFYPYYEKLEEELSDLIGEPITITAGITEALYLLGVW-MRG 85 
212223827  10 YHGGAR--EEGLLDFSASLNPYLPEWTGEMFERA-KSISNRYPYYRGLEEELSKLVGKPVTVTAGITEALYLIGILALKG 86 
150020752   7 GHGGIE--RKDFLDFSISVNPLKVNWLDKLS----LDEIYRYTYIQWLEKEFYKYFGG--VIVAGATEAFHIIGYHILND 78 
57640799   10 YHGGARrkEEGLIDFSASLNPYPPEWLDEMFERA-REISGHYPYYEELEEGLAELVGEPITVTAGITEALYLLGILALRG 88 
240102602   6 YHGGAR--EEGLLDFSASLNPYPPGWLDEMFKRA-KEISNRYPYYERLEEELEGLVGEPLIITAGITEALYLLGILALRG 82 
157364098   4 FHGGIN--REEFTDFSISVNPIKPPFFEKLFSNKlVEYCGKYTYIEQLEEKFAKRYGENTVILAGATEALQIIGFTLMED 81 
14590285   20 IHGGAR--KEGLIDFSASVNPYPPEWLSEVFERA-KDLSSRYIYYEELEEEFESLIGEPITITAGITEALYLLGILTLRN 96 
154250050  78 AVVIIPEPNYTEYERVARFSASKIvki--rvfQSEEDYFERIEKVIFeer---knsSRCVLITGNPNNPTGEYTNFSDFA 152
14520265   89 RKVIIPRHTYGEYERVARIFNAKI--------IKGSNEPEKLAELVE---------NNSVVFFCNPNNPDGRYYTPRELK 151
18976665   86 RKVIIPKHTYGEYERISRMFGGRV--------IKGPNDPGKLAEFVE---------RNSFVFFCNPNNPDGKFYREKEMK 148
212223827  87 RKVIIPRHTYGEYERVTKIFGAEV--------IPGPNDPEKLAELVE---------NESIVFFCNPNNPDGKFYSPKGLR 149
150020752  79 SYVIIPRPNYSDYFKVAKFSAKIIdtp--wyfVNKKLDLNVLEKSIKnar---kksKKVVVFLGNPNNPTGIFLNFSELV 153
57640799   89 RRVIVPAHTYGEYERVARIFGARV--------VKGPNDPEELSQLVE---------RDSVVFFCNPNNPDGRFYGKKELG 151
240102602  83 KKAIIPEHTYGEYERVSWIFGARV--------VKGPNEPEKLAELVE---------RNSVVFFCNPNNPDGRFYSVRELK 145
157364098  82 SEVIIPIPSYGEYARIASFKAHRIhfvdildyKNRKLDYSILENYIKdlkrknrsgKNTVIILGNPNNPTGYYEK--NIA 159
14590285   97 KRVIIPNHTYGEYERIARMFGAKV--------IKGPNDPSKLAELVE---------RESVVLFCNPNNPDGKYYTPKELK 159
154250050 153 KDIYKKYGKEVMIILDEAFIDFVPKGEQFElceldnLDNLIIVRTFTKILGVPGVRIGYVKSrsFREVFEKYRMPWGIGG 232
14520265  152 PLIDAVEDRKALLVLDEAFIDFVKDAKSPE------GENIVKLRTFTKSYGLPGIRVGYIIG--FRDAFRSVRMPWSIGS 223
18976665  149 PLLDAIQDTNSILILDEAFIDFVKKPESPE------GENIIRLRTFTKSYGLPGVRVGYVIG--FVDAFRSVRMPWSIGS 220
212223827 150 PLLDAVEDKGALLILDEAFIDFVKGAKSPE------GENLVKLRTFTKSYGLPGIRVGYVIG--FEEAFKSVRMPWSIGS 221
150020752 154 RFYEDV-----IFISDEAFIDFVEDYEEID------YENIIKVRTFTKFFGVPGIRVGYVKSknYEEVFRQYRMEWGVGG 222
57640799  152 PLLDAVEDRNALLVLDEAFIDFVESPESPS------GENIVKLRTFTKSYGLPGIRVGYVAG--FPEAFRSVRMPWAIGS 223
240102602 146 PLLDAVEDRGALLVLDEAFIDFVKKPDSPK------GENIVKLRTFTKSYGLPGVRVGYVLG--FEEAFRSVRMPWSIGS 217
157364098 160 SFVDRNIDERTTLVIDEAFVDFIPEKDRVDls---dFENTILIRTFTKFYSIPGIRAGYVKSknFKSLFESYRSPWAVGA 236
14590285  160 SLIDAVTDTNSLLILDEAFIDFVKKAKSPS------GENLIKLRTFTKSYGVPGIRIGYVIG--FSEAFRSVRMPWNIGA 231
154250050 233 SGYAVLKSLIEnfDDYKAFLs---ESSEYFKKERERFKNFSFFNSKTNYLVIDVGDSEEFQKFMHRNGLHVRTMEDFGMD 309
14520265  224 TGVAFLEFLIE--DNFEHLR----KTMPLIWQEKERIEKALNVKSDANFFIKYVGDAKKAVEELKKRGILVRDCTSFGLP 297
18976665  221 TGVAFLEFLLK--DNFKHLR----KTLPLIWKEKERIEKELKVKSDANFFIMKVRE--GIIEKLKENGILVRDCKSFGLP 292
212223827 222 LGYAFLEFLIE--DGFEHLK----KTMPLIWREKERMEKALDIKSDANFFIKRVGDAKAVVEALKRKGIAVRDCTSFGLP 295
150020752 223 LGYVFLKRLLEniEDFESFRc---KTLDYIRIQKHFFKDYMYVESQTNYFLLDVGNIDEFLDFCISREIFVRDARNFGL- 298
57640799  224 VGVAFLEFLLE--DRFQHLK----GTMPLIWREKRRIEKALGVKSDANFFIKYVRDAKKTVEELKRKGMLVRDCTSFGLP 297
240102602 218 TGVAFLEFLIE--DGFEHLR----RTMPLIWREKERIEKALGVKSDANFFIKRVGNAEGFVDAMKKRGILVRNCESFGLP 291
157364098 237 MGYLFLETLLR--EDIYALNrfekNTVEYTERERKKFEDFTYFISNTNYFVAEIGDVEKFLQILHHNKMHVRTMYDFKMS 314
14590285  232 VGVAFLEKVIE--DEFAHLR----RTLPLIWREKERIERRLGVKSDANFFIMNVGDARAVVEKLKKKGILVRDCSSFGLP 305
154250050 310 GFVRVGLKDRVANEKLRRLVEEWYF 334
14520265  298 GYIRFSVRRAEENERLVQALKDLSP 322
18976665  293 GYIRFSVRRREENDKLINILRKTLN 317
212223827 296 QYVRFSVRKREENERLIEAFRELGL 320
150020752 299 DLIRVGLKDEKSNIALLKTLKEGRL 323
57640799  298 QYVRFSVRKPEENDALVRALLEISP 322
240102602 292 EYIRFSVRKPEENEMLIRAFKSMRV 316
157364098 315 KFVRIGLKDEQSNEKLLNLLRDWRE 339
14590285  306 NYIRFSVRKPEENDKLIEALTSL-- 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap