Conserved Protein Domain Family
PRK08350

?
PRK08350: PRK08350 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 169397
View PSSM: PRK08350
Aligned: 7 rows
Threshold Bit Score: 572.52
Threshold Setting Gi: 242398339
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
14520752    1 MSVIQNIIGRVVVLRGGMYSVEVDVATDEGFGRFASPIEENPMLHIAEARRAVSEVDEIIGPELIGFDAVEQELIDSYLW 80 
14591403    1 MSVIQNIIGRIAVLRGGKYSVEVDVATDEGFGRFTSPIDDNPMLHIAEARRAVSEVDEIIGPELIGFDASEQELIDSYLW 80 
18978013    1 MSIIQDIIGRIVVLRGGQYSVEVDVVTDESFGRFAAPIDENPALYIAEARRAVSEVDEIIGPELIGFDAIDQELIDSYLW 80 
57641432    1 MTVIENIVGRVTVLRGGRYSVEVDVITSSGFGRFAAPVDENPDLYIAEAHRAVSEVDEIIGPELIGFDATEQELIDSYLW 80 
212223257   1 MTVIENVIGRVAVLKGGKYSVEVDVITSSGFGRFAAPIDENPSLYIAEAHRAVSEVDEIIGPELIGFDASEQELIDSYLW 80 
240104017   1 MTIIENVIGRVAVLRGGKYSVEVDVITSSGFGRFAAPIDEDPHLYIAEAHRAVSEVDEIIGPELIGFDASEQELIDSYLW 80 
242398339   1 MTVIENVVGRISVLKGGKYSVEIDVITTSGFGRFAAPIDEDPSLYIVEAHRAVSEVDEIIGPELIGFDSQEQELIDSYLW 80 
14520752   81 EIDGTEDFSHIGANTALAVSIAIARAAANSKDMSLYSYIGGTFATELPVPIIQFASDENFEYYILVRDLLEVTDIVDAVN 160
14591403   81 EIDGTEDFSHIGANTALAVSTAIAKAAANSRDMPLYSYIGGTFATELPVPVLSFAQDDMFDYYLVVKDLLEVTDIIDATN 160
18978013   81 EIDGTDNFSHIGANTALAVSVAVAKAAANSRNISLYSYIGGTFTTELPVPVVTFGADENFEYHVIVRDLLEVTDIIDAVV 160
57641432   81 EIDGTEDFSHIGANTALAVSVATAKAAASEKNLPLYTYLGGTFTTELPVPILEFASDSEFDYYVMVRDLMEITDVVDAVN 160
212223257  81 EIDGTEDFSHIGANTALAVSIAVAKAAASVKRMPLYSYIGGTFTTELPVPILEIANGEDFDYYVMVRDLMEITDVVDAAT 160
240104017  81 EIDGTDDFSHIGANTALAVSIAVAKAAASVKRLPLYSYIGGTFTTELPVPILEFAEDELFEYYVLVRDIMEITDVVDAVN 160
242398339  81 EIDGTEDLSHIGANTALAVSVAVAKAAANVKKVPLYSYIGGTFTTELPVPMLKFAEDDNFEYIVLVRDLMEISDVVDAMV 160
14520752  161 KIISEVgNKVSIEELSKASESVGMELGLEVALGIKMKRELEIEDVLNIVEDNNVAYIKPLGPPELFLELIAGTHGVFIDG 240
14591403  161 KIREIV-KEINLENLSKASEDVGVELGLEVALGIGMKKEMDIEKVLNLVEDYNVAYIKPIGPPELFLELIAGTHGVFIDG 239
18978013  161 RLLDFS---LSLEELSKASEQVGLELGLEVSLGITMRKELETEKVLEIVEDYNIAYIKPIGTPELFLELIAGTHGVFIDG 237
57641432  161 GVLSNL-KEATVEGYSEATEKASSELGLDVALGLAQKAPMDMEKLLTLVEDNNVAYLKPMGDEELFLELIAGTHGVFIDG 239
212223257 161 KVLENA-EGSTVEALSKATEKAGDELGLEVALGLVQKRPMETEEVLSIVEDNNIAYIKPIGDEELFLELIAGTHEVFVDG 239
240104017 161 KVLGTT-EAISLRALSEATEEAGKELGLEVSLGIALKSEIETEELLNLVEDNNIAYVKPVGSEELFLELIAGTHGVFIDG 239
242398339 161 KIKENS-REVALEGLSKASELAGDELGVEVALGLIQKRKMKLEEVLRTVEDYNIAYIKPLGEEELFLELIAGTHGIFVDG 239
14520752  241 EYLFRANNILDRRYYNALSIKPINLGTLTDLYNFVNDVKSEKITPILAEAKYEPADDTFPHLALGLRCPAMLISWNSVEK 320
14591403  240 EYLFRTNSVLDRRYYNALSIKPINLGTLTDLYNFVNDVKAEKITPILAEAKYEPADETFPHIALGLRCPAMLISWSSIEK 319
18978013  238 EYLYRKYNILDRKYYNALSIKPINLGTLTDLYNFVNDVKAEKITPILSESKYEPADETLPHLALGLRCPAMLIHMNSVEK 317
57641432  240 EYLFRQKDILDRRYYNALSIKPINLGTLTDLYNLINDAKSERIVPILAEARFESSDEALAHMAVGFRCPAVVLRKDSIAK 319
212223257 240 EHLFREKDILDRRYYNALSIKPINLGTLTDLYNLVNDAKSERITPILAEALYESSDEALAHLAVGLRCPAMVLRKDSIAK 319
240104017 240 EHLFRERGIIDRRYYNALSIKPINLGTLTDLYNLVNDVKSERITPILAEARYESADEALPHLAVGLKCPAMILGKDSVAK 319
242398339 240 EYLFKTRNILDRRYYNALSIKPINLGTLTDLYNLINDVKSERIAPILAEAKYESADEALPHLAVGFKCPAIMFHEGSLVK 319
14520752  321 INELNRIAEELGERGRIITFEE 342
14591403  320 INELNRIAEELGERGRIITFEE 341
18978013  318 INELNRIAEELGERGRIITFEE 339
57641432  320 LNELIRIAEDLGERGRVITFEG 341
212223257 320 LNELIRIAEDLGERGRIITFEG 341
240104017 320 MNELNRIAEDLGERGRLITFEE 341
242398339 320 INELIRIAEDLGERGRIITFEG 341
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap