Conserved Protein Domain Family
PRK08349

?
PRK08349: PRK08349 
hypothetical protein; Validated
Statistics
?
PSSM-Id: 169396
View PSSM: PRK08349
Aligned: 9 rows
Threshold Bit Score: 307.049
Threshold Setting Gi: 154151526
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154151526   2 AKLVSLISGGIDSPVAAYLMLHQGVEIIAVHMDNrpftDEKNLHKAMNLIRHLQHLTQRPIKTYVV-----PHGPNHIAF 76 
14591544    4 MRVIGLLSSGIDSPVAIHLMASRGAEVYPLHFRQ----DEIKEKKARKLVSRLKEIHGEKVKDLKVvdalkVQGPVFEKL 79 
14520567    1 MKVVALLSSGIDSPVAIHLVASKGAEVYPLHFKQ----DDVKENKVRRIVKRLQEIHGDKVKDPRIvdafeVQGPVFEKL 76 
18978207    1 MKVVALLSSGIDSPVAIHLMASRGVEVYPLHFRQ----DEVKERKVRKVVKKLQEIHGEKVKDPHTvnayeVQAPVFEKL 76 
57640301    1 MKAVALLSSGIDSPVAIYLMLRRGVEITPIHFRQ----DSIKEEKASEIVEILKRY--GKLSDPIIvnfseEHVPAFEKL 74 
212224155   1 MKAVALLSSGIDSPVAIYLMLRKGMEITPVHFKQ----SDKKESKVLELCEILSKY--GKLNEPVIvdayeEQAPVFSKL 74 
219852533   1 MKLISLISGGIDSPVATYLMICRGVEIVAVHMDNrpftDEKNLDKTLNLVRHLRTLTGTPIRTYVV-----PHGPNHTTI 75 
240103541   1 MKAVALLSSGIDSPVAVYLMLRRGVEVVPVHFRQ----DPIKEEKVRELWEVLSKY--GKLDELIVvdfaeEHVPVFERL 74 
242398344  12 VKAVALLSSGIDSPVAIYLMLKKGFTVYPIHFMQ----SEVNHQKVRRIWMRLKELYPDSLEELIAvdafeYQKPIFDKL 87 
154151526  77 ARNCERHLHCLFCRRMMYRIAERIAEKEGAVGILTGESLGQVASQTLQNLMVENLVIRIPVVRPLIGMDKVEIIDIARRI 156
14591544   80 RELKREKWICIFCKYTMYMVAEKYAREVGAEAIVTGDSLGQVASQTLDNLMVISTATNLPIIRPLIALDKEEIVRIAKEI 159
14520567   77 REIRKEKWTCIFCKYTMYIVATSYAREIKAKAIVTGDSLGQVASQTLDNLMVMSTATELPILRPLIALDKEEIVRIAKEI 156
18978207   77 KEIKKGKWTCVFCKYTMYIVAESYAKKVGASAIITGDSLGQVASQTLDNLLVISTATKLPVIRPLIGLDKEEIVKIAKEI 156
57640301   75 RELGKIKYTCVLCKWLMLRKACRIGHEIGASAIITGDSLGQVASQTLDNLMVVSTASDLPILRPLIGLDKEEIVRIAKEI 154
212224155  75 VEIGKAKWTCLFCKYTMLRKACRVGHEIGAKAIVTGDSLGQVASQTLDNLLIISQASDLPILRPLIGRDKEEIVKIAKEI 154
219852533  76 ARNCNRHLHCLFCRRMMYRIAEQIAEKEGADGILTGESVGQVASQTLQNLSVVNRAIKYPVIRPLIGFDKVEIIEIARTI 155
240103541  75 KELKKERWTCIFCKWLMLRRACRIGHEVGASAIITGDSLGQVASQTLDNLMIVSSASDLPVLRPLIGMDKEEIVKIAKEI 154
242398344  88 IELKKEKWICIFCKFSMLMKAAEIAKEKNAMVIITGDSLGQVASQTLDNLLIISLATDLPVLRPLIGMDKVEIEKIAKEI 167
154151526 157 GTYEISTLPGLCCTIVPKKPATAARAGDilgeeqkldlrvlIEKSLEGMYVLDPE 211
14591544  160 GTFEISIENEPPCPFLPKFPVVRAGFSQ-------------FRKILEEIREVLPK 201
14520567  157 GTFDISTEKEPPCPFVPRFPVVRAGLGE-------------FRKILNEVKDLLPK 198
18978207  157 GTFEISIEEEPPCPFVPKFPVVRAGLGE-------------FQKILSQVKDKLPR 198
57640301  155 GTFEISSRKEPPCPFTPKYPVVRASLGE-------------FQKILQDLI----- 191
212224155 155 GTFEISIEPEEPCPFVPKYPVVRGSLGE-------------FEKIREKLVKEGVL 196
219852533 156 GTYEISTLPGLCCTIVPKHPSTAAKLEDvlneeskididslVEKSLEGMYVFGPE 210
240103541 155 GTFEISAREEPPCPFTPRYPIVRGSPGG-------------FRKVLEELRRCGNS 196
242398344 168 GTFEISIEPEESCNFVPRHPIIRGALGE-------------FKKIYREVFGKEC- 208
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap