Conserved Protein Domain Family
PRK08340

?
PRK08340: PRK08340 
SDR family oxidoreductase
Statistics
?
PSSM-Id: 169390
View PSSM: PRK08340
Aligned: 7 rows
Threshold Bit Score: 437.699
Threshold Setting Gi: 124028225
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18978225    1 MNILITASSRGIGFNVAKELLKKGHRVVISSSNEKNLEKALEELKEYEKVY--PIKADLSKKEEIKNMVEKAWEILGKID 78 
14520584    1 MRILITAASRGIGFNIAKELLKKGHEVSIASSNPDNIRKAYEKLKEIGEIH--YFKADLKSKDDIKLLIKEAWEAMGAID 78 
57640608    1 MRVIVTASSRGIGFNVARELLKRNARVVISSRNSEHLKMAEKELAEFGEVQ--TVKANLYDQRELENLVKTSWELLDGID 78 
212223852  10 LGVIVTASSRGIGFNVARELLKRNARVVISSRSEENLKKALDELSPLGEVY--AVKTNLCDQRDLENLVKESWELLGGVG 87 
124028225  12 VNVLVTASSRGIGFYAARGLARLGASVAISSRSREALERAAKEIKEETGVEpiAIQADLTRRDDLVRLVEEAWDGLGGLD 91 
14591562    3 MKVLITASSRGIGFNLAKELLNKGHEVTITSSNIRNIENAYKELRELGTVH--YFQADLSSKEDIKRMVKDAWDAMGRIE 80 
240103075   1 MGVIVTASSRGIGFNVARELLKRNARVVISSRNEENLRKALDELLSYGEVY--SVEANLFDQKNLENLVKESWELLGGVD 78 
18978225   79 VLVWNAPNVKCEPCMIHELDYEDWVEGALLHIIAPGYLTTLLLNKWLKNNTRGIIIYLSSASVLEPMPPLLLADSTRAGL 158
14520584   79 ALVWNAPNVGCEPCMAHEARYIDWLEAALLHIVAPGYITTLLIQAWLEKKMRGVIIYLSSASVLEPMPPLILADTARAGL 158
57640608   79 ALIWNAGNVRCEPCFLHEATYMDWLEAAALHSVAPGYLTTLLVQTWLEKKMKGTLVYLNSVSVKEPMPPLVLADVTRAGL 158
212223852  88 ALVWNAGNVRCEPCLLHEAGYDDWVEAAKLHAVAPGYLTTLLVQTWLEGKRKGVLVYLNSVSIKEPMPPLVLADVTRAGL 167
124028225  92 ALVFNAGNVSCEPCHLEDAGYSDWLEAARLHLVAPGFLTSLLLPRFL-RRGSGVFVYLSSVSVKAPMTPFALADVSRAGL 170
14591562   81 ALIWNAPNVKCEPCMVHEARYRDWLEAALLHLVSPGYITTLLIQAWLEKKIKGVLIYLSSASVLEPMPPLLLADTARAGL 160
240103075  79 ALVWNAGNVRCEPCLLHEATYLDWIEASALHTVAPGYLTTLLIREWLERKRKGVLVYLNSVSIKEPMPPLVLADVTRAGL 158
18978225  159 IQLAKGISRAYGKRGIRAYTVLLGSFDTPGARENLRRLAEKRGVDPEELWKKEVIERTPLQRTGKWEELGELIEFLLSDN 238
14520584  159 VQLAKGISRTYGGKGIRAYTVLLGSFDTPGARENLARIAEERGVTMDEIWEREVIDRTPLKRTGRWSELGALIDFLLSEN 238
57640608  159 IQLAKSVSRTYGKYGIRAYSVLLGSFDTPGARENLRKLAEERGEPFEETWEREVLSRTPLHRTGRWEELGSLVAFLLSEE 238
212223852 168 VQLAKSVSRTYGKHGIRAYSVLLGSFDTPGARENLKAVAESRGEIFEETWEREVLGRTPLHRTGGWDELGSLVAFLLSDE 247
124028225 171 VQLAKLVARSYGGRGIRAYTVLLGSFDTPGARRNVARIGESMGLSPEEAWRKLVLEATPLGRVARPEELANLLAFLLSPS 250
14591562  161 VQLTKGITRAYGGKGIRAYVVLLGSFDTPGARENLAKIAEERGMSLEEIWRKEVIERTPLKRTGKWSELGALIDFLLSEN 240
240103075 159 VQLAKSVSRTYGSKGIRAYSVLLGSFDTPGARENLKAVAEARGKSFEETWEREVLSRTPLRRTGRWSELGSLVAFLLSDE 238
18978225  239 AEYMLGSTILFDGAMTRSVLL 259
14520584  239 AEYMLGSTIVFDGAMTRGVNL 259
57640608  239 AEYMLGSTVVIDGAMTRAVDI 259
212223852 248 AEYMLGSTVVIDGAMTRGINL 268
124028225 251 AEYMNGATIVMDGAMTPCT-- 269
14591562  241 AEYMMGSTILFDGAMTRGVNL 261
240103075 239 AEYMLGSTVVIDGAMTRSVDL 259
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap