Conserved Protein Domain Family
PRK08339

?
PRK08339: PRK08339 
short chain dehydrogenase; Provisional
Statistics
?
PSSM-Id: 169389
View PSSM: PRK08339
Aligned: 7 rows
Threshold Bit Score: 449.306
Threshold Setting Gi: 119720724
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
14520480    1 MLKIDLSGKLAFTTASSKGIGFGVARVLAKAGADVIILSRNEENLKRAREKIKEESNVEVHYIVADLTKMDDLERTVKEL 80 
161349998   1 MLRIDLSGKLAFTTASSKGIGFGVARVLARAGADVIILSRNEENLKRAKEKIKSESNVEVHYIVADLTKMEDLERTIKEL 80 
242398692   1 MLSIDLSGRLAFTTASSKGIGFGVARVLARAGADVILLSRNEENLKKAREKIKEESNVDVSYIIADLMKREELEKTVKEL 80 
57640671    1 MLGIDLSGKLAFTTASSKGIGFGVARVLAKAGADVVLLSRSEENLKRAKEKIRAASDVEVSYIVADLTRREDLERTVKEL 80 
18976521    1 MLKIDLSGKLAFTTASSKGIGFGVAKVLAMAGADVIILSRNEENLKKAKEKIKEIADVNVEYIVADLTKKEDLERIVGEV 80 
240103275   1 MIGIDLSGRLAFTTASSKGIGFGVARVLARAGADVILLSRSEENLKKAREKIMSESSVDVSYIIADLTKREDLERTVREL 80 
119720724   2 ALKIDLSGKLSLTTASSRGIGFGVARVLARCGSDVILVSRSAEGLEKARSAILSESPVDVFTVQADLTRREDLERMVKEV 81 
14520480   81 KNIGEPDIFFFSTGGPKPGYFMEMSMEDWEEAVKLLLYPAIYLTKALVPAMERKGFGRIIYSTSVAIKEPIPNIALSNVV 160
161349998  81 KDIGDPDIFFFSTGGPKPGYFMEMSMEDWEGAVKLLLYPAVYLTKALVPGMERKGFGRIVYSTSVAIKEPIPNIALSNVV 160
242398692  81 QNIGEPDMFFFSTGGPKPGYFMEMSMEDWEGAVKLLLYPAVYLTKALVPAMEKKGFGRIVYSTSGAIKEPIPNIALSNVV 160
57640671   81 KDIGEPDIFFFSTGGPKPGYFMEMDMEDWEGAVKLLLYPAVYLTRALVPAMERKGFGRIVYSTSVAIKEPIPNIALSNVV 160
18976521   81 KNIGDPDIFFYSTGGPKPGYFMEMTMEDWEEAVKLLLYPAVYLTRALVPGMEKKGFGRIIYSTSVAIKEPIPNIALSNVV 160
240103275  81 SEIGEPDVFFFSTGGPKPGYFMEMSMEDWEKAVRLLLYPAVYLTRAIVPAMERKGFGRIIYSTSVAIKEPIPNIALSNVV 160
119720724  82 LGIGVPDVFFYSTGGPRPGSFLELSMDDWDSAYRLLVYPAVYITRSILPGMVEKRWGRLIYLSSLAIKEPMPNLALSNVM 161
14520480  161 RIAMAGLVRTLAKELGPKGITVNGIMPGIIRTDRMIQLAQDRAKREGKTVEEALQEYAKPIPLGRLGEPEEIGYLVAFLA 240
161349998 161 RIAMAGLVRTLAKELGPKGITVNGIMPGIIRTDRVIQLAQDRAKREGKSVEEALKEYAKPIPLGRLGEPEEIGYLVAFLA 240
242398692 161 RISMAGLVRTLAKELGPKGITVNGIMPGIIRTDRMVQLAKDRAKREGKSVEEALQEYAKPIPLGRLGEPEEIGYLVAFLA 240
57640671  161 RISMAGLVRTLAKELGPKGITVNGIMPGIIKTDRMIRLAKDRAQREGKTVEEALQEYAKPIPLGRLGEPEEIGYLVAFLA 240
18976521  161 RISLAGLVRTLAKELGPKGITVNGIMPGIIRTDRVIQLAQDKARREGKSLEEALQDYAKPIPLGRLGEPEEIGYLVAFLS 240
240103275 161 RISMAGLVRTLAKELGPKGITVNGIMPGIIRTDRVIQLAEDRAKREGKTIEEALAEYAKPIPAGRLGEPEEIGYLVAFLA 240
119720724 162 RIAIAGLVRTLAREVGRYGITVNGIMPGTIKTSRVEELAADIARRQGVSLDEAYRQLARDIPAGRLGYPEEIGYLVAFLA 241
14520480  241 SDLGSYINGAMIPVDGGRLNSVF 263
161349998 241 SELGSYINGAMIPVDGGRLNSVF 263
242398692 241 SDLGSYINGAMIPVDGGRLNSVF 263
57640671  241 SDLGGYINGSMIPVDGGRLNSVF 263
18976521  241 SELGSYINGAMIPVDGGRLNSVF 263
240103275 241 SDLGSYINGAMIPVDGGRLNSVF 263
119720724 242 SDYASYINGAMIPVDGGRQVSVF 264
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap