Conserved Protein Domain Family
PRK08335

?
PRK08335: PRK08335 
translation initiation factor IF-2B subunit alpha; Validated
Statistics
?
PSSM-Id: 169387
View PSSM: PRK08335
Aligned: 7 rows
Threshold Bit Score: 499.689
Threshold Setting Gi: 242398479
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
14590355    1 MLPERVLEILREMKRERIKGASWLAKKGAEAFLTLAEELDESLLEDAIMELREEVVKVNPSMASLYNLARFIPVTNRRDI 80 
242398479   1 MLPQEVEELIREMSEERIRGASYLAQMGAKAYARLAEILEGEEFLNGLKDLGVEILNVNPTMASLYNLVRFIPIIDNPEF 80 
57640982    1 MLPPEIRSLLEDMRVERIRGASWMAQKGAEAYLLLADLLEGNELKNALQEMREELPKVNPTMASLYNLVMFIPITDDPGL 80 
18976847    1 MLPEKVVKILEEMKNEKIRGASWMAKKGAEAFILLSEELDETSLEEGIIELKREILEINPSMASLYNLAMFIPITNDREV 80 
212223785   1 MLPPEIRSILEEMRAERIRGASYLAKRGAEVYIKLAELLSGDGLREALKDMREEIPAVNRTMASLYNLARFIPITDNPDL 80 
240103725   1 MIPPQVREILEEMRTERIRGASWLAKKGAEAYLLLSELLVGKELERALSEMRKEIPSINPTMASLYNLSRFIPVSSSPEL 80 
14521790    1 MLPDRVLEILNEMKAERIRGATWLARKGAEAFLALAEELDEALLEDAIRELRSRIIEVNPSMASLYNLARFMPITNNREL 80 
14590355   81 LKSRALEFLRRMEEAKRELASIGAQLIDDGDVIITHSFSSTVLEIIRTAKERKKRFKVILTESSPDYEGLHLARELEFSG 160
242398479  81 VAAKANEFIRLSEEAKREIGNIGSELIDQNEIIITHSYSSTVLEILKKAKEKGKAFKVIISESGPDYEGLFFAKKLEEFE 160
57640982   81 LKSRAEEFLRLINEAKKEIGNIGSELIDNGDIVITHSFSSAVLEVFTSAKRKGRSFKVILTESAPDFEGLALANELSALG 160
18976847   81 VKLRAEEFIKRAEEAKKEIASIGAQLIDSGDVIITHSYSSAVFEILKTAKRRGKQFKVILTESAPDYEGLYLAKALQDES 160
212223785  81 VISKAEEFIRLSEEAKREIGNIGSELIDENEVIITHSFSSAVLEIFKAAKRKGKRFKVILTESAPDYEGLALAGELEALE 160
240103725  81 VRARAEEFLRLMDEARREIGNIGSELVDDGEVVITHSFSSAVLEVLSSAWRKGKRFRVILTESSPDYEGIALANELDFLG 160
14521790   81 VKMRALEFLRRMDEAKRELASIGAQLIDDGDVIITHSFSSSVLEIFKVAKDRRKSFKVIITESSPDYEGLHLANELENLG 160
14590355  161 IEFEVITDAQMGLFCREASIAIVGADMITKDGYVVNKAGTYLLALACHENAIPFYVAAETYKFHPTLKSGDVMLMERDLI 240
242398479 161 IPFEVITDAQLGLFAKNATLALVGADNITKDGYVFNKAGTYLLALACNDNGIPFYVAAETFKIHPEARAEDIKIIERKFK 240
57640982  161 ISYEVITDAQVGLFSKEATLALVGADNVTRDGAVVNKAGTYPLALACYDNGVPFYAAAESFKFHPELNSGDVELVERPYA 240
18976847  161 IEVEIITDAQLGLFAKDATLAIVGADTVTKDGYVVNKAGTYLLAISCYESEVPFYVAAETYKFHQKITSKEVELVERPLY 240
212223785 161 IPFEVITDAQIGIFVKKATLAFVGADNVTRDGAVVNKAGTYLLALACHDNGVPFYVAAESFKLHPELNSEEVEIVERPYA 240
240103725 161 IPHEVITDAQLGLFARRATLALVGADNVTRDGAVLNKAGTYLLALACHDAGVPFYVAAESFKFHPELEAEEVEIVERPYH 240
14521790  161 IEFEVITDSQMGLFCRKATISMVGADMVTRDGFVVNKAGTYLLALACHESDVPFYVAAETYKFHPTVKSNEVVLHERDFS 240
14590355  241 RGNVRIRNVLFDVTPWKYVRGIITELGIVIPPRDI 275
242398479 241 RDHIIIRNYLFDATPWKYIRGIITELGILVPPKEI 275
57640982  241 RNGHRVRNVLFDVTPWKYVRGIITELGILVPPREI 275
18976847  241 REGSRVRNVLFDITPWKFIRGIITELGIILPPRDM 275
212223785 241 RQGYRVRNYLFDITPWKYVRGIVTELGILVPPKEI 275
240103725 241 RQGHRVRNYLFDVTPWKYVRGIITELGVLVPPKEI 275
14521790  241 RSGFRVRNVLFDLTPWKFIRGIITELGIVIPPRDI 275
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap